KEGG   Arcobacter nitrofigilis: Arnit_1746
Entry
Arnit_1746        CDS       T01235                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
ant  Arcobacter nitrofigilis
Brite
KEGG Orthology (KO) [BR:ant00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ant02044]
    Arnit_1746
Secretion system [BR:ant02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Arnit_1746
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADG93400
UniProt: D5V1G6
Position
1740810..1741802
AA seq 330 aa
MRIDEINYNIKPSTFKYTLPQAIRICFGYLKMIYKNKNSDDLYNNHIVFKSNHSLSFQRS
ELSNIDFIETKEKIYVEITLNFLGIFGSASPLPVHYSELVLESFDSDRILYDFLNLFNHN
LQKFIYPIWEKHRYYVQYKKGLKDRFSKYILSFLGLYGHLENSSSLNLEKLIPYMGILIM
KHKSAGTLKSILRHYLSHDEIEIIQCIPANYNIPSFQYSSLGQKNISLGSNFLIGESILS
KNIKFRILLKNVTSEDLIKFSIKGDKLTQISDLISFSLNEPLEHEICLKIKKENKVKFLL
SKKEDRYIGINTWLGISDYDEEIIMAQEGK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgagaattgatgaaattaactataatataaaaccttcgacttttaaatatactttacca
caggcaataagaatttgttttggatatttaaaaatgatttataaaaataaaaattctgat
gatttgtataacaatcatatagtttttaaatcaaaccacagtttatcttttcaaagatca
gaattatcaaatattgattttatagaaacaaaagaaaaaatatatgtggaaattacatta
aattttttaggaatatttggaagtgcatctcctcttcctgtacattacagtgaattagta
ctagaaagttttgattcagatagaattttatatgattttttaaacttattcaatcataat
ttacaaaaatttatctatcctatttgggaaaaacatagatattatgttcaatataaaaaa
ggacttaaagatagattttcgaaatatattttatcttttttaggactatatgggcacctt
gaaaactcatcttcattaaacctagaaaaactaataccatacatgggtattctaataatg
aaacataaatcagcaggaacattaaaatcaatattaagacactatttatctcatgatgaa
attgagattattcagtgtattcctgcaaattataatataccttcttttcaatactcttct
ttaggacaaaaaaacatatctttaggaagtaacttcctaataggggaatcaatattaagt
aaaaatattaaatttagaatacttctcaaaaatgtaacttctgaagatctaataaaattt
agtattaaaggggataagttaactcaaataagtgatttaatatctttttctctcaatgaa
cctcttgaacacgaaatttgtttgaaaataaaaaaagaaaataaagttaagtttttattg
agtaagaaagaagatagatatataggtataaatacttggttagggatatctgactatgac
gaagaaataataatggcacaagaaggaaaataa

DBGET integrated database retrieval system