KEGG   Arcobacter nitrofigilis: Arnit_1750
Entry
Arnit_1750        CDS       T01235                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
ant  Arcobacter nitrofigilis
Pathway
ant03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ant00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Arnit_1750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ant02044]
    Arnit_1750
Secretion system [BR:ant02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Arnit_1750
SSDB
Motif
Pfam: T6SS-SciN DUF5643
Other DBs
NCBI-ProteinID: ADG93404
UniProt: D5V1H0
Position
1745778..1746227
AA seq 149 aa
MNIKFSIFMLISFIILITGCASKPTHLELVIKSAKDLNPDIDTVSSPLMLTFYELESAEK
FLKYDFWRIVDDSGKNLEPELISQSKQIIIPSQEQTYNIVFDDKAKFLGIIAKFRNIDGN
NWRQVINLEKDSYNFSEFEIKKFTIKRVE
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaatattaaatttagtatatttatgttaataagttttattatacttattacaggctgt
gcttctaaacctactcatttagagttagtaataaagtctgcaaaagatttaaatcccgat
attgatactgtttcttctccacttatgttaactttttacgaactagaaagtgctgagaag
tttttaaaatatgatttttggagaatagtagatgattctggtaaaaatcttgaacctgaa
ttgatttcacaatcaaaacaaattattattccttctcaagaacaaacatacaatattgtt
tttgatgataaagcaaaatttttaggaattattgcaaagtttagaaatattgatggaaat
aattggagacaagtaatcaatttagaaaaagattcttacaatttttccgagtttgaaata
aaaaaatttaccataaagagagttgaataa

DBGET integrated database retrieval system