KEGG   Arcobacter nitrofigilis: Arnit_1751
Entry
Arnit_1751        CDS       T01235                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
ant  Arcobacter nitrofigilis
Brite
KEGG Orthology (KO) [BR:ant00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ant02044]
    Arnit_1751
Secretion system [BR:ant02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Arnit_1751
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ADG93405
UniProt: D5V1H1
Position
1746227..1747558
AA seq 443 aa
MQNNVVWKEGLFIRPQHFQQSDRYYNNEIITRTLNARPNNWGFYNLEIDEHLLNTGKIVI
KRASGIMPDGTLFNIDPKVNSLILNIEKIDSGKNVYLALPIFIDRSDTVHFEDQKNLSTR
LKAVNSSNIPNTNAGENSSCDILTAELNFKLLLEEELNENYTSLLITKVGSVSTSNIVSL
DTNFTPTFLHLDSASVLSSKIKEILSMISYRIKKLSEKISDSSLQATELSNYLMLQLLNK
AENKFHFLISQNKVHPDILFYELSNLVAELAIFMKKEKRIINHITYLHYQQSESFDKLIT
ELKDMLTLVLDENSISLPIEKRKFGIYISALKDKKIVQDSTFIFSVSTSMPSNKIKEILV
ASLKLGTIETIKNLVNFHLIGFKIKPLSTPPKEIPYRVNLLYFKIELTQENRDELMKSAG
FAFHLGSEIPDISYSLWAIKNNN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcaaaataatgttgtatggaaagagggactatttattagaccccaacatttccaacaa
agtgatagatattataataatgaaataataacaagaaccttgaatgcaagacctaataat
tggggtttttataatttagaaattgatgaacacttactaaatacaggaaagattgtcatt
aaaagagcatcaggaataatgccagatgggacactttttaatatagatccaaaagttaat
agtctaattttaaatattgaaaaaatagatagtgggaaaaatgtttacttggctttgcca
atatttatagatagaagtgatactgtacattttgaagatcaaaaaaacttatctactaga
ttaaaagctgtaaatagttcaaatatacccaatactaacgcaggtgaaaatagtagctgt
gatattttaacagcagaattaaatttcaaacttttattagaagaggaattaaatgaaaac
tatacatcattattaattacaaaagtaggttctgtttcaacaagtaatattgtttcttta
gatacaaattttactcctacatttttgcatttagattctgcatcagttttatcatcaaaa
ataaaagaaattttatcaatgatttcatatagaattaaaaaattatctgaaaaaattagt
gattcctctttgcaagcaacagagctttctaattatttgatgcttcaactattaaataaa
gccgaaaataaatttcattttttaatttcacaaaataaagttcaccctgatattttattt
tatgaattaagtaatttagtagctgaactagccatttttatgaaaaaagaaaaaagaatc
atcaatcatattacttatcttcattaccaacaaagtgaatcttttgataaattaattaca
gaacttaaagatatgcttaccttagttcttgatgaaaatagtatttctttacctatagaa
aaaagaaaatttggtatttatatatctgctttaaaagacaaaaaaatcgttcaagattca
acattcattttttctgtttcaacaagtatgccttcgaataaaatcaaagaaatattagta
gcaagtcttaaattagggacaattgaaacaataaaaaatcttgttaattttcatttaatt
ggatttaagatcaagcctctttctacacctcctaaagagattccatatagagtaaattta
ctttattttaaaattgaattaactcaagaaaatagagatgaattgatgaaatctgctggt
tttgctttccatttaggttctgaaattccagatataagttattctctatgggcaataaaa
aacaataattaa

DBGET integrated database retrieval system