KEGG   Arcobacter nitrofigilis: Arnit_1757
Entry
Arnit_1757        CDS       T01235                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ant  Arcobacter nitrofigilis
Pathway
ant03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ant00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Arnit_1757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ant02044]
    Arnit_1757
Secretion system [BR:ant02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Arnit_1757
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Linker_histone DUF2345
Other DBs
NCBI-ProteinID: ADG93411
UniProt: D5V1H7
Position
1754154..1757060
AA seq 968 aa
MSKEIIRNNVEEIEEGLKSGVNLKELRREVKQDINARIKLLNYKPNATVGIIDGSFNVYK
LLGSSSVNTPYSFTITFVSDDFINIEDIVDTDIELNIKDNVNPLIKKTIYGKIFKASEDS
IVAKKHLYIIEVVSPIYYLSLNNKYEIFHNKKTSDIIVEIINRYNQLLNLKIDIKLDLIK
APTKEYTTQYNQNDLEFIQMLCEKEGYSLILDYSSNDPYTITLCELNEHAIVNTYSSTCS
FNHSKEFKSTNYVQDFYDKDKPSLQYKIQTGSSITSSVEDNESTRQLRTDIKREKFRDKL
NVLDESYYKDLNRYSKIDSQREYVKSNIIKGTSEELNINDSLCITLEDEKANKHIDSIIL
EVKYEGFFPNALDEYKQNIDESKKHQLQYEVEFTAIPKDIIYKPPYKIKKPKINSIQTAI
VSNGNSNTKDYTNTIDVDEQGRIKVLFHFETNQITSCYLRLSNMFSGDGYGSQFLPRVNS
EVIVSFINGDPDLPIIIGTLHNGENKNPYNLPKEKTKSFIKTHSIPQYEDKIGYNEIAFE
DKRGDENLSLRAQKDMNTLVLNNEFKHIENNSKTIINNDKEETVEANSILTINKDYTQNI
KENQINTVEKEKLTTVKEDYEIHALKDLNTIVKNDIKTIVEKDMITRVKGTSTEYIEKDV
KKKYLENLFTQVGKDYRLDVQNNYHLKSNNIKLNADIIELIAETGVTLRCGGNVLTVNQS
GIHLKSGNIDTTSSNGGVNAQDVAKPLIKKPLYEKIRVISLDATVTKQNTIDEALTFTAT
VEKYENDAWSQTTDLNETQLAQLQWYFIKNNDESDTDIITDNPTNDNITINGLTLTVNVQ
EDNIYKWGHAHCYVVNSEEEGYAISELERYLEVEDIKGSYPKKEEGKCKAILNVEEPRDE
ELAQIRWTVEGREESKYNGQVIINHNLKDEKAYEINFQAYIEGKKEDAANGRLYYDENKN
QEVKSNTK
NT seq 2907 nt   +upstreamnt  +downstreamnt
atgtcaaaagagataataagaaataatgtagaagagatagaagagggactaaagagtggg
gtaaacttaaaagagcttagacgtgaagttaaacaagatataaatgcaagaataaaacta
ttaaactataaaccaaatgctacagttggcattatagatggaagttttaatgtttataaa
cttttaggttctagtagtgttaatactccttactcttttactattacttttgttagtgat
gattttattaatattgaagatattgttgatactgatattgagttaaatattaaagataat
gttaatcctttaattaaaaaaacaatatatggtaaaatatttaaagctagtgaagattct
attgttgcaaagaaacatctttatattatagaagttgtatctcctatttattatcttagt
ttaaataataaatatgagatatttcacaataaaaaaacatctgatattattgttgagata
ataaatagatataaccaattattaaatttaaaaatagatattaaattagatttaattaaa
gctccaactaaagagtatacaactcaatataatcaaaatgatttagagtttattcaaatg
ctttgtgagaaggagggttatagtttaattcttgattattcttctaatgatccatatact
ataactctttgtgaattaaatgaacatgctattgtaaatacttattcttctacttgtagt
tttaatcatagtaaagagtttaaatctacaaactatgtacaagacttttatgataaagat
aaaccaagtttacaatataaaatccaaacaggttctagtataacttctagtgttgaagac
aatgaaagtactagacagttaagaactgatataaaaagagaaaagtttagagataagtta
aatgtattagacgagtcttattataaagacttaaatagatacagtaaaatagactctcaa
agggaatatgtaaaatcaaatattataaaaggaacttctgaggagttaaatataaatgac
tcattatgtataacattagaagatgaaaaagcaaataagcatattgattctattatctta
gaagtaaaatatgaaggcttctttccaaatgctttagatgagtataaacaaaacatagat
gagagtaaaaaacatcaacttcaatatgaagtagaatttacagccattccaaaagatata
atatataaaccaccatataaaataaaaaagcctaaaataaactcaatacaaacagcaata
gtatctaatggcaattctaatacaaaagattatactaatacaatagatgtggatgaacaa
ggtagaataaaagtattgtttcactttgagactaatcaaataacttcttgttatttaaga
ttatcaaatatgtttagtggtgatggatatggttctcaatttcttccaagagttaactct
gaagtaatagtaagctttataaatggtgatccagatttacctattataataggaactttg
cataatggtgaaaataaaaatccatataatcttccaaaagagaaaacaaaatcttttata
aaaacccattctattccacaatatgaagacaaaatagggtacaacgaaatagcctttgaa
gataaaagaggagatgagaatttatctttaagagcacaaaaggatatgaatacccttgta
cttaataatgagttcaaacatatagagaataattcaaagactattattaataatgacaaa
gaagagactgtagaagctaattctattttaactataaataaagactatacccaaaatata
aaagaaaatcagataaatactgtagaaaaagaaaaacttactactgttaaagaagattat
gaaattcacgcacttaaagatttgaacactattgttaagaatgacattaagactattgtg
gaaaaagacatgataacaagagtaaaaggaacttcaacagagtatatagaaaaagatgta
aagaaaaaatacttagaaaatctatttactcaagtaggaaaagactatagacttgatgtt
caaaataactatcatcttaaaagtaataatataaaattaaatgcagatattatagaacta
atagcagaaacaggagttactttaagatgtgggggaaatgtattaacagtaaatcaaagt
ggaatacacctaaaatcaggaaatatcgatacaacttcaagtaatggtggagtaaatgca
caagatgttgcaaaaccacttattaaaaaaccattgtatgaaaagataagagtaatctct
ttagatgctacagttacaaaacaaaatactatagacgaagcattgactttcacagcaaca
gtagaaaaatatgaaaatgatgcatggagtcaaacaactgatttaaacgaaacccaatta
gctcaactgcaatggtacttcataaaaaacaatgatgaaagtgatactgacatcataaca
gataatccaacaaatgataatatcacaataaatggtcttactcttacagtaaatgttcaa
gaagacaatatatataaatggggacatgcgcattgttatgttgtaaatagtgaagaagaa
ggttatgcaataagtgaacttgaaagatatcttgaagtggaagatatcaaaggttcttac
ccaaaaaaagaagagggtaaatgtaaagctatattaaatgtagaagaaccaagagatgaa
gagttagcacaaataagatggacagtagaaggaagagaagaatcaaaatataatggacaa
gtgataatcaatcataaccttaaagatgaaaaagcatatgaaataaacttccaagcatat
attgaaggcaaaaaagaagatgctgccaatggaagactttattatgatgaaaataaaaat
caagaagtaaaaagcaatacaaaataa

DBGET integrated database retrieval system