KEGG   Arcobacter nitrofigilis: Arnit_1760
Entry
Arnit_1760        CDS       T01235                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ant  Arcobacter nitrofigilis
Pathway
ant03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ant00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Arnit_1760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ant02044]
    Arnit_1760
Secretion system [BR:ant02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Arnit_1760
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: ADG93414
UniProt: D5V1I0
Position
1760774..1763308
AA seq 844 aa
MSKEIIRNNVEEIEEGLKSGVNLKELRREVKQDINARIKLLNYKPNATVGIIDGSFNVYK
LLGSSSVNTPYSFTITFVSDDFINIEDIVDTDIELNIKDNVNPLIKKTIYGKIFKASEDS
IVAKKHLYIIEVVSPIYYLSLNNKYEIFHNKKTSDIIVEIINRYNQLLNLKIDIKLDLIK
APTKEYTTQYNQNDLEFIQMLCEKEGYSLILDYSSNDPYTITLCELNEHAIVNTYSSTCS
FNHSKEFKSTNYVQDFYDKDKPSLQYKIQTGSSITSSVEDNESTRQLRTDIKREKFRDKL
NVLDESYYKDLNRYSKIDSQREYVKSNIIKGTSEELNINDSLCITLEDEKANKHIDSIIL
EVKYEGFFPNALDEYKQNIDESKKHQLQYEVEFTAIPKDIIYKPPYKIKKPKINSIQTAI
VSNGNSNTKDYTNTIDVDEQGRIKVLFHFETNQITSCYLRLSNMFSGDGYGSQFLPRVNS
EVIVSFINGDPDLPIIIGTLHNGENKNPYNLPKEKTKSFIKTHSIPQYEDKIGYNEIAFE
DKRGDENLSLRAQKDMNTLVLNDEFKHIENNSKTIINNDKEETVEANSILTVNKDYTQNI
KENQINTVEKEKLTTVKEDYEIHALKDLNTIVKNDIKTIVENDVTTSIKNILLKYVEKDA
SDKYLESLFIQVANELGVNIKDSFHLDTTNALYEGSNEITLEAKTGISLRCGGNIATVDS
SGIHFNTPNYVKNSGNDGVNGVEVQYTGDIINLRADDTNRVFLSEVIEDDYILRADTSLK
EGTSVEATCFILGEEEKILAQKSKTINVKNSQLEAVFDLDEIKNKNQLDINDIEKYKGKM
QWEA
NT seq 2535 nt   +upstreamnt  +downstreamnt
atgtcaaaagagataataagaaataatgtagaagagatagaagagggactaaagagtggg
gtaaacttaaaagagcttagacgtgaagttaaacaagatataaatgcaagaataaaacta
ttaaactataaaccaaatgctacagttggcattatagatggaagttttaatgtttataaa
cttttaggttctagtagtgttaatactccttactcttttactattacttttgttagtgat
gattttattaatattgaagatattgttgatactgatattgagttaaatattaaagataat
gttaatcctttaattaaaaaaacaatatatggtaaaatatttaaagctagtgaagattct
attgttgcaaagaaacatctttatattatagaagttgtatctcctatttattatcttagt
ttaaataataaatatgagatatttcacaataaaaaaacatctgatattattgttgagata
ataaatagatataaccaattattaaatttaaaaatagatattaaattagatttaattaaa
gctccaactaaagagtatacaactcaatataatcaaaatgatttagagtttattcaaatg
ctttgtgagaaggagggttatagtttaattcttgattattcttctaatgatccatatact
ataactctttgtgaattaaatgaacatgctattgtaaatacttattcttctacttgtagt
tttaatcatagtaaagagtttaaatctacaaactatgtacaagacttttatgataaagat
aaaccaagtttacaatataaaatccaaacaggttctagtataacttctagtgttgaagac
aatgaaagtactagacagttaagaactgatataaaaagagaaaagtttagagataagtta
aatgtattagacgagtcttattataaagacttaaatagatacagtaaaatagactctcaa
agggaatatgtaaaatcaaatattataaaaggaacttctgaggagttaaatataaatgac
tcattatgtataacattagaagatgaaaaagcaaataagcatattgattctattatctta
gaagtaaaatatgaaggcttctttccaaatgctttagatgagtataaacaaaacatagat
gagagtaaaaaacatcaacttcaatatgaagtagaatttacagccattccaaaagatata
atatataaaccaccatataaaataaaaaagcctaaaataaactcaatacaaacagcaata
gtatctaatggcaattctaatacaaaagattatactaatacaatagatgtggatgaacaa
ggtagaataaaagtattgtttcactttgagactaatcaaataacttcttgttatttaaga
ttatcaaatatgtttagtggtgatggatatggttctcaatttcttccaagagttaactct
gaagtaatagtaagctttataaatggtgatccagatttacctattataataggaactttg
cataatggtgaaaataaaaatccatataatcttccaaaagagaaaacaaaatcttttata
aaaacccattctattccacaatatgaagacaaaatagggtacaacgaaatagcctttgaa
gataaaagaggagatgagaatttatctttaagagcacaaaaggatatgaatacccttgta
cttaatgatgagtttaaacatatagagaataattcaaagactattattaataatgacaaa
gaagagacagtagaagcaaactctattttaacagtaaataaagactatacacaaaatata
aaagaaaatcagataaatactgtagaaaaagaaaaacttactactgttaaagaagattat
gaaattcacgcacttaaagatttgaacactattgttaagaatgacattaagactattgtg
gaaaatgatgtaacaacttcgattaaaaatatacttttaaaatatgtagaaaaagatgca
agtgataaatacctagaaagtctttttattcaagtagcaaatgaactaggagtaaatata
aaagatagcttccatcttgatacaacaaacgccttatatgaaggttcaaatgagataacc
ttagaagcaaaaacaggaataagtctaagatgtggaggaaatatagccactgtagatagt
tcaggaatacattttaatactcctaattatgttaagaattcagggaatgatggggttaat
ggggtggaagtacaatatacaggagatataataaatttaagagctgatgatacaaataga
gtatttcttagtgaagttatagaagatgattatattttaagagcagatacaagtctaaaa
gaaggaacaagtgttgaagcaacttgttttatattaggtgaagaagaaaaaattttagca
caaaaaagtaaaacaataaatgttaaaaactcacaacttgaagctgtttttgatttggat
gaaataaaaaataaaaaccaattagatatcaatgatatagaaaagtacaagggaaagatg
caatgggaagcttag

DBGET integrated database retrieval system