KEGG   Arcobacter nitrofigilis: Arnit_2354Help
Entry
Arnit_2354        CDS       T01235                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00330  Arginine and proline metabolism
ant00332  Carbapenem biosynthesis
ant01100  Metabolic pathways
ant01130  Biosynthesis of antibiotics
ant01230  Biosynthesis of amino acids
Module
ant_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Arnit_2354
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Arnit_2354
Enzymes [BR:ant01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Arnit_2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ADG94005
UniProt: D5V143
Position
complement(2349204..2349968)
Genome map
AA seq 254 aa AA seqDB search
MKRIVIKVGSAVLREGNVLAVDRLNNLVDLIAKLKAEKKYEIILVSSGAVAAGNITLELD
RTKVLNRQALAAIGQPLLMKHYKKRFREHGFTCAQMLLVANDFDSRKRSKNAKGVMEILL
ENNIIPILNENDVIANEELLIGDNDQLGAHAAIFFDADMLVILSDVDGLYDCNPHENPEA
KMRKIVSFLKEDELEMKYSPNSEFATGGIVTKLKAANLLLKNDKMMYLSSGFDLTNAYDF
LLKEDHKSGTLFKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatagttattaaagttgggagtgctgttttacgagaaggtaatgttctagca
gttgatcgattaaataatttagttgacttaatagcaaaattaaaagcagaaaaaaaatat
gagattattttagtctcttctggagcagttgctgctggaaatataactttagagttagat
agaacaaaggttctaaatagacaagccttagcagcaattgggcaacccttattgatgaaa
cattacaaaaaaagatttagagaacatggatttacttgtgctcaaatgcttcttgttgca
aatgattttgattctagaaaaagatctaaaaatgcaaaaggtgtgatggaaattttatta
gaaaataatatcattcctattttaaatgaaaatgatgtaattgcaaatgaagaacttcta
ataggagataatgatcaattgggtgcacatgcagcaattttctttgatgcagatatgtta
gtaattctttctgatgttgatggtctatatgattgtaatccccatgaaaatccagaagca
aaaatgagaaaaatagttagttttttaaaagaagatgagttagagatgaaatatagtcca
aactcagagtttgcaactggtgggattgttacaaagttaaaagctgcaaaccttttatta
aaaaatgacaaaatgatgtatctatcttctggttttgatttaacaaatgcatatgatttt
ttattaaaagaagatcataaaagtggaactctatttaaaaaataa

DBGET integrated database retrieval system