KEGG   Arcobacter nitrofigilis: Arnit_2736Help
Entry
Arnit_2736        CDS       T01235                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00471  D-Glutamine and D-glutamate metabolism
ant01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ant00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Arnit_2736
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ant01011]
    Arnit_2736
Enzymes [BR:ant01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Arnit_2736
Peptidoglycan biosynthesis and degradation proteins [BR:ant01011]
 Precursor biosynthesis
  Racemase
   Arnit_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race baeRF_family10
Motif
Other DBs
NCBI-ProteinID: ADG94384
UniProt: D5V6W4
Position
complement(2756504..2757304)
Genome map
AA seq 266 aa AA seqDB search
MKVGVFDSGIGGLTVVKAITEVLKGAEIFYIADTKFAPYGEKSKEQILKHSFNIANYLVK
THNIDALVVACNTATSAAIKELREEFPNLIVVGTEPGIKPAISLSKNGKIGILATPATLK
GEKYQLLVDKLSNASSNITLYEQACPGLVQQIENGDIEGEKTFEMLKNWLKPMSEKGVDT
IVLGCTHYPLVGNVIKKIMGENTNLIETGYAIANRLKDLSKNCGHFNDGVLKVNVYFTSD
INETMISKILNSWNNGGKIVVRNINE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtaggcgtatttgattctggaattggtggtttaacagttgtaaaagccataaca
gaagtactaaaaggtgctgagattttttatattgcagatacaaagtttgcaccctatggg
gaaaaatcaaaagaacagatattaaaacatagttttaatattgcaaattatttagttaaa
acacataatattgatgctttggttgttgcttgtaatacggcaacttcagctgcaataaaa
gagttaagagaagagtttcctaatctaattgttgtgggaacagagcctggtataaaacca
gcaatctctttgagcaaaaatggaaaaataggaatcttagcaacacctgcaactttgaag
ggtgaaaagtatcaattacttgtggataaattatcaaatgcaagttcaaatatcacttta
tatgagcaagcttgtccagggctagttcaacaaattgaaaatggtgatattgaaggtgaa
aagacatttgagatgttgaaaaattggctaaagcctatgagtgaaaagggtgttgatact
atagttttaggatgtacccattatcctttagttggaaatgtaataaaaaaaataatgggc
gaaaatacaaatctaatagaaacaggttatgctattgcaaacagattaaaagatttatct
aaaaattgtggacattttaatgatggtgtattgaaagtaaatgtatacttcacttcagat
ataaatgagacaatgataagtaaaatattaaattcatggaataacggtgggaaaatagtg
gtaaggaatataaatgagtga

DBGET integrated database retrieval system