KEGG   Aneurinibacillus sp. XH2: ACH33_01275Help
Entry
ACH33_01275       CDS       T04247                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx00071  Fatty acid degradation
anx00072  Synthesis and degradation of ketone bodies
anx00280  Valine, leucine and isoleucine degradation
anx00310  Lysine degradation
anx00362  Benzoate degradation
anx00380  Tryptophan metabolism
anx00620  Pyruvate metabolism
anx00630  Glyoxylate and dicarboxylate metabolism
anx00640  Propanoate metabolism
anx00650  Butanoate metabolism
anx00900  Terpenoid backbone biosynthesis
anx01100  Metabolic pathways
anx01110  Biosynthesis of secondary metabolites
anx01120  Microbial metabolism in diverse environments
anx01130  Biosynthesis of antibiotics
anx01200  Carbon metabolism
anx01212  Fatty acid metabolism
anx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:anx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACH33_01275
   00630 Glyoxylate and dicarboxylate metabolism
    ACH33_01275
   00640 Propanoate metabolism
    ACH33_01275
   00650 Butanoate metabolism
    ACH33_01275
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACH33_01275
   00072 Synthesis and degradation of ketone bodies
    ACH33_01275
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACH33_01275
   00310 Lysine degradation
    ACH33_01275
   00380 Tryptophan metabolism
    ACH33_01275
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACH33_01275
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACH33_01275
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACH33_01275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anx04147]
    ACH33_01275
Enzymes [BR:anx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACH33_01275
Exosome [BR:anx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACH33_01275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMA71600
UniProt: A0A0X8D682
Position
255122..256309
Genome map
AA seq 395 aa AA seqDB search
MRKSVIVSAARTPFGKFGGSLSSLQAVELGGIVIKEAVKRAGISPDMVDEVIMGMVLQGG
AGQIPSRQAARKAGLPWEVQTETINKVCASGLRSVTLADQIIRAQDADIIVAGGMESMSN
APYALPNTRWGMRMGDGKLVDLMLRDGLTDAYDGKHMAVHGSNVAAEYKITREEQDKWAL
RSQQRAAAAIKAGRLKEEIVPVEVPQRKGDPVIVEQDEAPRETSLEQLQNLPPVFTKDGT
ITAGNAPGVNDGAGAMVVMSDEKAKELGIKPLATILGHAAVGQEAPYIATTPGLAINKLL
KKTGYTIDQIDLFEVNEAFAAVVLTSQKIAGWDPEKVNVNGGAIAFGHPIGASGARILMT
LIYELRRRGGGLGIAAICSGAAQGDAILVEVQAAK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatccgtaatcgtaagtgcggcccggactccatttggtaaatttggtggtagc
ctttcctcgctgcaagcggttgagcttggaggcattgtgattaaagaggccgtaaaacgc
gctggaatctctcccgatatggtcgatgaagttatcatgggcatggtgctgcaaggagga
gcaggacaaatcccttctcgccaggcggcgcgcaaggcaggattgccctgggaagtacag
acggagacgattaacaaagtatgtgcatccggcctgcgcagcgtaacgttagccgatcag
atcattcgtgcccaagatgcggacattatcgttgcgggcggcatggagagcatgagcaac
gcaccgtatgctttgccaaacacgcgttggggcatgcgcatgggggatggcaaactggtg
gacttgatgcttagggatgggttaaccgacgcgtacgatggcaagcatatggcagtacac
ggcagcaatgtagccgcagaatacaaaattacgcgcgaggaacaggataagtgggcgctc
cgcagtcagcagcgtgcggcggcggcgataaaagctggcaggctgaaagaggaaattgta
ccggtggaagtgcctcagcgcaaaggcgatccggttatcgtcgagcaggatgaagcaccg
cgtgagacgagccttgagcaactacagaatctgcctcctgtatttacaaaagacggtaca
attacggccggcaatgcgccaggcgtaaatgatggagcaggcgctatggttgttatgtct
gacgaaaaagcgaaagagcttggtattaagccgctggcgacgattcttgggcatgcggcc
gtcggacaagaagccccgtatatcgcgaccacgccgggcctcgcgattaataaattgctt
aagaaaaccggttatacaattgaccagatcgatttgtttgaagtgaatgaagcgtttgca
gccgttgtgcttacaagccagaaaattgctggatgggacccggaaaaagtaaatgtcaac
ggaggagccatcgcgtttggccatccgattggtgcaagcggagcccgtatcttaatgacg
ttgatttacgaattgcgacgtcgcggcggcggtctcggcattgccgcaatttgttccggc
gcggcgcaaggtgacgcgattctggtggaagttcaggctgccaaataa

DBGET integrated database retrieval system