KEGG   Aneurinibacillus sp. XH2: ACH33_02690Help
Entry
ACH33_02690       CDS       T04247                                 

Definition
(GenBank) homocysteine methyltransferase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx00270  Cysteine and methionine metabolism
anx00670  One carbon pool by folate
anx01100  Metabolic pathways
anx01110  Biosynthesis of secondary metabolites
anx01120  Microbial metabolism in diverse environments
anx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:anx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ACH33_02690
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ACH33_02690
Enzymes [BR:anx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ACH33_02690
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     ACH33_02690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AMA71851
UniProt: A0A0X8D263
Position
555067..556929
Genome map
AA seq 620 aa AA seqDB search
MTMPKESLKTYLKDHLLIGDGAMATWLYQLGIPIGVCYEELNLSNPELIRAVHRSYYEAG
ARFIQTNTYGAHRDALARHGLQDKVTRINRVAVQVAREAVKDDAYVVGGIGSINAGRVRD
VRMQNYREQFEEQAAALLMGGVDAILLETFLDLDELLLALDVIRPLTDVPIVAQLATIEV
GRTRDGHTLTRAFAELKKAGADVVGLNCRLGPAEILRSIENAVVPEDTPLSVFPNAGRLA
MSDGQYSYASVPQYFGENALRFRAQGARLIGGCCGTTPEHIRVMAQVLAEREPLPRVNPV
VDTQEEAEPLIRIDPPARKQGIVETVAHRHTVIVELDPPRDLDTEKFLRGTAALQDAGAD
AITLADNSLATTRMSNMALGSIMKAKFGAEPLLHIACRDRNLIGQQSHLMGLHALGINQV
LVVTGDPARFGDLPGASSVFDVSSFDLIRMIKQLNEGYSFSGKPLKQRANFVVGAAFNPH
VRQFDAALRRLEKKVEAGADFIMTQPLYDRESIERIYEGTRHLDIPIFIGIMPLTSSRNA
EFLHNEVPGIRLSDEARTRMRRYEPGEEARREGVAIARELVDIAMEYFKGIYLITPFFYY
EMTVELTRYIRDRSRVVLQK
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgccaaaagaaagcttgaaaacataccttaaggatcatttgcttatcggggac
ggcgcgatggcgacctggctgtaccaattgggcattccgattggcgtgtgttatgaggaa
ttgaatttatccaatccagagcttattcgcgcggttcaccgctcgtattatgaggcgggc
gcacgatttattcaaactaacacatacggagcgcaccgggacgcgctggcgcgccatggt
ttgcaggacaaagtgacacggatcaatcgggtggcagtgcaggtggcgcgagaagcggtt
aaagatgacgcgtatgtggtcgggggtatcggctctattaacgcaggacgtgtgcgagat
gtgcgtatgcaaaattatcgcgaacaatttgaggagcaggcagcggcgcttttaatgggc
ggtgtggatgcgattttgctggaaacatttcttgatctggatgaattgctgctggcgctg
gatgtgattcgtccgttaaccgatgtgccgatcgtggctcaactggccacgattgaggtc
ggacggacgcgagatggtcacacgctaactcgggcgtttgccgagttgaaaaaagcgggc
gcggatgttgtcgggttaaactgccggcttggaccggcggaaatcttacgttcgattgaa
aatgcagtggttccggaggacacgccgctgtccgtctttccgaacgccgggcggttggct
atgtcagatggccagtattcatacgcgtctgtgccacaatatttcggggaaaacgcgctt
cgtttccgtgctcagggcgcacgcttgattgggggctgttgtggaacaacaccggaacat
atccgggtaatggcgcaggtgctggcggaacgagagccgttgccgcgcgtgaatcctgtt
gtagacacgcaagaagaagcggagccgctgattcgcatcgatcctccggcccggaaacag
ggaattgtggaaacggtggcgcatcggcatacggtgattgttgagttagacccgccacgc
gatttagatacagaaaagtttttacggggcacggcggcattgcaggacgctggggcggac
gcgattacgctcgctgacaattcgctggcgacgacgcggatgagcaatatggctcttggt
tcgattatgaaggcgaaattcggcgctgagccactgttgcacattgcctgtcgcgaccgc
aacctgatcggccagcaatcgcatctaatgggtttgcatgcgctcggtattaaccaggtg
cttgttgttacaggagatccggcccgtttcggcgatctgccgggagcaagctccgtgttc
gatgtttcatcatttgatttaattcggatgattaaacagttgaacgagggatattctttc
tcagggaagccgttgaagcagcgggcgaatttcgtggtcggtgctgcatttaatccgcat
gtgcgccagtttgacgccgcgctgcgccggctggaaaagaaagtggaagcgggcgcggat
tttattatgacccagccgttgtatgaccgggagagcattgagcggatttatgaaggaacc
aggcatctcgatatcccgatttttatcggtattatgccgctgaccagttcgcgcaatgcc
gaatttttgcataacgaagtaccgggtattaggctatcagacgaggcgcgcacccgcatg
cgccggtatgaaccgggggaagaagcgcgccgtgaaggggtagcgatcgcccgtgagctg
gtagatatcgcaatggagtactttaaaggcatttatctgattacaccgtttttctactat
gagatgacagtggagttaacccggtatatacgggacagatcacgggttgtgttgcagaag
taa

DBGET integrated database retrieval system