KEGG   Aneurinibacillus sp. XH2: ACH33_03890Help
Entry
ACH33_03890       CDS       T04247                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:anx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACH33_03890
Enzymes [BR:anx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ACH33_03890
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ACH33_03890
    1.1.1.-  
     ACH33_03890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc TrkA_N F420_oxidored 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AMA72071
UniProt: A0A0X8D094
Position
797539..798606
Genome map
AA seq 355 aa AA seqDB search
MKAARWYGVKDVRVEEIPEQQVKPGMVKIRVEWCGICGTDLHEYLAGPIFLPSKEPHPLT
NEKVPLVLGHEFAGEIVEIGESVTKFKVGDRVAVEPILNCGECGACRSGIYNLCEKLGFH
GLAGGGGGFSEYTVVKENMVHKLPDQMSYEQGAMVEPAAVAVHAIRQSKLQVGDKVAVFG
AGPIGLLMIQAAKAAGASQIIAVELSEERREFAQKVGADIVLDPKSVDVVKEIQTLTNGG
VDVSFEVAGVERVLNQAIESAKFDGQIIIVSVWEKAATILPNSLVLKEREMKGILGYRDI
FPEVIQLIANGSIKAEELITKKINIDHIIEEGFETLVKEKSHVKILVSPRAFYLT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgatggtacggagttaaagatgtccgtgtagaggaaattcccgagcaa
caagtaaagccgggtatggtaaaaataagagtggaatggtgcgggatctgcggtaccgac
ttgcatgaatatttagcaggtcccattttccttccttcaaaagaacctcatcctttaacg
aatgaaaaagtacctcttgtgcttggacatgaatttgcaggtgaaattgtagagattggt
gaaagcgttaccaaatttaaagtaggtgaccgggttgcagtagagccgattcttaattgt
ggggagtgcggtgcctgtagatcgggaatttacaatctttgtgaaaagctcggatttcat
ggtctggccggaggcggcggtggcttctctgaatacacggtggtcaaagaaaacatggtt
cataaattaccggatcaaatgagttatgaacaaggggctatggtagaacctgccgcggtt
gcggtacatgcgataagacaaagcaaacttcaagttggtgacaaagttgcggtgtttggt
gcaggaccaatcggtctgttaatgattcaagccgcgaaagctgcaggtgcaagtcaaatt
attgctgtcgaactttcagaagaacgcagagaattcgcccaaaaagtcggtgcggacatt
gtcttggatccgaaaagtgtggatgtagtaaaagaaattcaaacccttacaaatggaggg
gttgacgtaagttttgaggttgccggtgtggaaagggttttaaatcaagcgattgagagc
gcaaaatttgacggacaaattattattgtcagtgtttgggaaaaagcagcaaccatcctt
ccaaacagccttgtcttaaaagagcgtgaaatgaaagggatacttggctatcgagatatc
tttccggaagtgatccaactgatcgcgaacggcagcatcaaagcggaagaactgattacg
aaaaaaattaacattgatcacattatcgaagaagggtttgaaacgttggtgaaagagaaa
agccatgtgaaaatcttggtaagtccaagagctttctatttaacatga

DBGET integrated database retrieval system