KEGG   Aneurinibacillus sp. XH2: ACH33_11740Help
Entry
ACH33_11740       CDS       T04247                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-hydroxylase
  KO
K16901  anthranilate 3-monooxygenase (FAD) / 4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.8 1.14.14.9]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx00350  Tyrosine metabolism
anx00380  Tryptophan metabolism
anx01100  Metabolic pathways
anx01120  Microbial metabolism in diverse environments
anx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:anx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ACH33_11740
   00380 Tryptophan metabolism
    ACH33_11740
Enzymes [BR:anx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.8  anthranilate 3-monooxygenase (FAD)
     ACH33_11740
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     ACH33_11740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB
Motif
Other DBs
NCBI-ProteinID: AMA73461
UniProt: A0A109QD29
Position
complement(2387044..2388522)
Genome map
AA seq 492 aa AA seqDB search
MGIRTGEQYINAVKSRKPEVWLAGKKVENVFDEPVLRQTVIEIAKLYDMQHDPEYQDKIT
HFCEETGERVNNAFLIPKNYEDLIKRRAAFEAFAKATFGLMGRSPDFLNVVITSMYSHSS
FFEKYNKQWAENIRRYYRLVRDNDLFLTHAIINPQNDRSKSSHEQQDMFTHLGAVKETPE
GLVVRGAKFLATLAPVADEVIIYTFPGYKPGDERYALAFALPIDTPGLRIICREPMQDGK
RPLFDHPLASRFEEIDALLVFKDVLVPWDRVFIYNNVEAANLLYPKTGIAQQPAHQSAVR
GLLKLQFATEVTCRLADSIGVDVFLHVQESLGELIQAVESIRALLRIAEHEYEVTPEGEA
MPNWVPLETIRGLLPKMYPRAIELMQTIGAGGLLLSPTGADFENPELREDIERYYIGRAG
VSATDRVSVFKLAWDLCGEAFGQRLLQYERYYTGDPIRKKAIFYNSIKRQRTFDMVDDAL
QVSKLKELVTNK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcgtacaggtgagcagtacattaatgcagtaaaatcacgaaagcctgaggtt
tggctggcaggaaaaaaggttgaaaacgtatttgatgaacctgtattaagacagacagta
attgaaatcgcaaagctatatgatatgcaacatgatccggaatatcaagataagattact
catttctgtgaagaaactggggaaagagtgaacaatgcgtttttgattccgaagaattac
gaagatttaattaagcgtagagcggcgtttgaagctttcgcgaaggctacttttggttta
atgggaagatctccggactttttaaacgtagtaattacctccatgtacagccattctagt
ttctttgaaaagtacaataagcaatgggctgaaaacatacgcagatattatcgattggtt
cgtgataatgacttgtttttaacgcatgccatcatcaatcctcaaaatgatcgaagcaaa
tcctctcatgagcaacaggatatgtttactcatttaggagctgtgaaagagacaccggaa
ggacttgttgtgagaggtgctaaatttttggctacactcgctcctgtggcagatgaagtt
attatttacaccttcccaggatataaacccggtgatgaacgttatgcgctagcattcgcg
ctaccaattgatacgccaggccttcgaattatttgtcgtgaaccgatgcaggatggaaaa
cgtccgttgtttgatcatccattggcatcacgctttgaagaaatagatgcgttgttagtc
tttaaggatgttttagttccctgggatcgagtgtttatttataacaatgtggaagccgca
aacctcctttatccaaaaacaggaatcgcccagcagccagctcatcagtctgcagtgaga
ggactcttaaaacttcaatttgctacagaagtaacatgtaggttagctgactcaattgga
gtagatgtatttttacatgttcaggaaagccttggtgagttaatccaagctgtagaatct
ataagggcattattgcgtattgcagagcatgagtatgaagttactcctgagggggaggct
atgccaaattgggtaccccttgaaacgattcgaggtttattaccaaagatgtatccacgt
gctattgaactgatgcaaaccataggagctggtggattattgctgtctccaactggtgct
gattttgaaaatccggaattaagagaagatatagaacgttactatattggaagagcgggt
gtatctgcaacggatcgtgtaagcgtattcaagcttgcttgggatttgtgcggcgaagct
ttcggtcagcgcttacttcaatatgaacgttattatacaggcgacccaatccggaagaaa
gctatattttacaattcaattaaacgtcagcgtacgtttgacatggttgatgacgcatta
caggtaagcaagttgaaagaactagtaacaaataaataa

DBGET integrated database retrieval system