KEGG   Aneurinibacillus sp. XH2: ACH33_12810Help
Entry
ACH33_12810       CDS       T04247                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx00310  Lysine degradation
anx01100  Metabolic pathways
anx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:anx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    ACH33_12810
Enzymes [BR:anx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     ACH33_12810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 Mqo Pyr_redox_2 Pyr_redox_3 NAD_binding_8 Amino_oxidase Thi4 Trp_halogenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AMA73649
UniProt: A0A0X8D4I4
Position
complement(2594651..2595883)
Genome map
AA seq 410 aa AA seqDB search
MYDFAIVGGGIVGLSTGMALMKRFPGAKIVMIEKEADWARHQTGHNSGVIHSGIYYKPGS
FKARFAREGNAAMVKFCEEHGIAYEVCGKVIVATEPEELPLMDNLYKRGLQNQLNVTKIG
PEELKEIEPHVRGLGAIRVPSCGIADYKGVARTFARMIEEGGGDLRLSTKVENIAEEKGG
VTVETNRGTIKARFLINCAGLHSDRVAKMADMHTGMKIVPFRGEYYELIPEKRHLVKHLI
YPVPNPNFPFLGVHFTRMINGEVHAGPNAVLAFKREGYTKKDISLKDLFEVLTYSGFWKM
AMPNMKEGINEMVRSFSKQAFLRSLQRLIPELTEKDIVPTHAGVRAQAIMHDGSMVDDFA
IFSGKRSMHVCNAPSPAATASIKIGEEIANRVPDHMIDNIKKTIAPAVLV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgcgattgtcggcggagggatcgtaggcttatcgacagggatggcgctc
atgaagcggtttccgggtgcaaagatcgtcatgattgaaaaagaagccgattgggcccgg
caccagacgggacacaatagcggtgttattcattccgggatttattataagcctggcagt
tttaaagcgcgttttgcacgggaagggaatgcagcgatggtgaagttctgtgaagaacac
ggcattgcatatgaagtgtgcggcaaggtgattgtagcaacagagccggaagagttgccg
ctgatggacaatttatataagcgcggtttgcagaatcaattgaacgtaacgaaaattggc
ccggaagaattgaaagagattgaaccgcatgtgcgcggccttggcgcgattcgtgtgccg
agttgcgggatcgcggactataaaggagttgctcgcacgtttgcgcgaatgattgaagag
ggtggcggtgacttgcgcctgtccaccaaagtggagaatattgccgaggaaaaaggcggc
gtcacagttgaaacaaatcgcggcacgattaaagcacgcttcctgattaactgtgccggc
ttgcacagtgaccgggtagccaaaatggccgatatgcacaccgggatgaaaatcgtgcca
ttccgtggtgaatactatgaattgattcctgaaaaacgccatctcgtaaaacatttaatt
tatccggtgcctaacccgaactttcccttcctcggtgttcattttactcgtatgattaat
ggggaagttcacgctgggccgaacgcagtattagccttcaagcgtgaaggttacaccaaa
aaggatatcagtttgaaggatctgtttgaggtgttaacctattcaggcttctggaaaatg
gcaatgccaaatatgaaggaaggtatcaacgaaatggttcgctctttcagcaaacaggcg
tttctgcgcagtttgcaacgtctgattccagaattgactgagaaagatattgtcccgacc
catgccggggtgcgggcacaggcgatcatgcacgatggaagcatggtggacgatttcgcc
attttttcaggtaaacgctcgatgcatgtatgcaatgccccttcaccagcagccacagcc
tctatcaaaatcggtgaagagatcgcaaatcgtgtgccggatcatatgatagacaatata
aagaaaacgatagccccggccgttctggtatag

DBGET integrated database retrieval system