KEGG   Aneurinibacillus sp. XH2: ACH33_13450Help
Entry
ACH33_13450       CDS       T04247                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx00020  Citrate cycle (TCA cycle)
anx00620  Pyruvate metabolism
anx01100  Metabolic pathways
anx01120  Microbial metabolism in diverse environments
anx01200  Carbon metabolism
anx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:anx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACH33_13450
   00620 Pyruvate metabolism
    ACH33_13450
Enzymes [BR:anx01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     ACH33_13450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C HlyD_D23 ATP-grasp_3 HlyD_3 RimK ATP-grasp_4 ATPgrasp_ST RnfC_N GCV_H GARS_A NQRA PTS_EIIA_1 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AMA73758
UniProt: A0A0X8D5H4
Position
2718133..2721588
Genome map
AA seq 1151 aa AA seqDB search
MAQIKTFKKVLVANRGEIAIRIFRACTELGIRTVAVYSEQDNIALHRFKADEAYVIGEGK
GPIEAYLDIEGIIEIAKRHDVDAIHPGYGFLSENEQFARRCEEEGITFIGPTSEHIRMFG
DKVTARQMAIEAGIPVIPGTPEPVRTLEEALRFVKEHGYPIIIKASSGGGGRGMRIVRKQ
DELQSALDRARSEAKSAFGNPAVYLEKYLEHPKHIEVQILADRYGHAVHLFERDCSIQRR
HQKVVEVAPSLSLTERQREDICNAALRLAKTSRYINAGTVEFLVTPDGNFYFIEVNPRIQ
VEHTITEMITGIDIVQSQIRIAEGYALEDPEVGIPSQSSVQMRGYAIQSRVTTEDPENNF
LPDTGRLLAYRSASGFGVRLDAGIGAPGATITPYYDSLLVKVSTHALTFERAARKMLRTL
KEFRIRGVKTNIPFLENVMQHPDFLRGTYDTSFIDTKPELFEFPKRKDRGTKLLTYIGQT
IVNGHPGLAKMDKKPTFPKARIPETSYWQEYPVGTKQILDEHGPEGVVKWIQQQKKLLLT
DTTFRDAHQSLLATRVRTYDLLQIAEATGKLAPDLFSLEMWGGATFDTSMRFLNEDPWER
LLKLREKIPNLLFQMLFRGANAVGYTNYPDNVIQKFIETAARAGIDVFRIFDSLNWVEGM
RLAIETVRETGKIAEAAICYTGDILNPKRDKYNLKYYVNLAKELEKAGAHILAIKDMAGL
LKPYAAYELIKALKQEIGIPIHLHTHDTSGNAGAMLLKASEAGVDIVDVALSSMSGLTSQ
PSLNAIAYALEHHERTPGLCHENYQKLADYWEDVRKYYVGFETEMKASNAEVYKHEMPGG
QYTNLEQQAKAVGLGDRWGEVKEMYATVNRMFGDIVKVTPSSKVVGDMALFMVQNNLNEQ
NVYEKGETIDFPESVITFFQGYLGQPYGGFPEELQRIILKGREAFTTRPGELLPSADFDE
IRAMLEEKLERSVTDYDLMSYVMYPQVFLDMQKRQQEFGDVSVLDTPTFFYGLRLGEEIA
VDIEQGKTLIVKLVSIGEVRPDGMRTIYYELNGQPREINVRDASAKVTTVQRAKADPSEL
GQIGASMPGKVLKIMVEQGDKVKKGEHVIVTEAMKMETTMQAPFDGVVKEIHVKEGDSIE
TGDLLLVIVKK
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcaaaacgttcaaaaaagtactggtggccaaccgcggcgagattgccatc
cgaattttccgagcctgcacggagcttggcattcgcacagttgccgtgtattccgagcaa
gacaatattgctctgcatcgttttaaagctgacgaagcgtatgtcatcggagaaggcaaa
ggcccaatcgaagcctatctggacattgagggcatcatcgaaatcgccaaacgccatgac
gtcgatgccattcatcccggttacggcttcctgtcggaaaacgaacaattcgcccgacgt
tgtgaagaagaaggcatcacgttcattggtccgacatctgaacacatccgcatgttcggc
gataaagtgaccgcccgccaaatggcgatcgaagctggcattccggtcatccccggcacc
ccggaaccagtacgcacgctcgaagaagcgcttcgtttcgtcaaagagcatggctatccc
attatcatcaaagcgtcgtccgggggcggcggtcgcggcatgcgcatcgttcgcaagcag
gatgaactgcaaagcgccctcgaccgcgcccgttccgaagcgaagtccgcgttcggcaac
ccggctgtttatcttgaaaaatatcttgaacacccgaaacatatcgaagtacagatcttg
gctgaccggtatgggcacgccgtccacctgttcgagcgcgactgttccatccagcgccgg
caccaaaaggtggtcgaagtcgccccaagcctgtccttgactgagcgacagcgggaagac
atctgcaatgcagccctgcgcttggccaagacgtcccgttacatcaatgccggtacggtc
gaatttctggtcacacccgatgggaatttctattttatcgaagtgaatccgcgcattcaa
gtcgagcacacgattacagagatgatcaccggaattgatatcgtgcaatcgcaaatccgc
atcgcggaaggatatgcgttagaagatccggaagtcggcattccatctcagtcgagcgta
caaatgcgtgggtacgccattcaatcgcgtgtgacaacagaagatccggaaaacaacttt
ctaccggatactggccgcctgctcgcataccgttcggccagcgggttcggcgttcgtctg
gacgcaggaatcggcgcgcctggcgccaccatcacaccatactacgattctctgctcgtg
aaagtgtcgacacatgcgctcacatttgaacgcgctgcgcgaaaaatgctgcgcacgctc
aaggaattccggattcgcggggtaaagactaacatcccgttcttagaaaacgtcatgcaa
cacccggatttcctgcgcggcacatacgacacctcttttattgatacgaagccggaattg
ttcgagtttccaaaacgaaaagaccgcggcaccaagctgcttacctatatcggccagacg
attgtcaacgggcacccaggcttggcgaagatggacaaaaaaccaacatttccgaaagcg
cgtatcccggaaacttcatattggcaggaatacccagtaggcaccaaacaaattctggac
gagcacggaccggaaggcgtagtgaaatggattcagcaacagaaaaaactgctgctcact
gatacgacgtttcgtgatgcgcaccagtcgctgctcgcaacccgtgtccgcacatacgac
ttgctacaaatcgccgaagcgaccggcaagcttgcgcccgatttgttctcgctggaaatg
tggggtggcgcgacgtttgatacgagcatgcgctttttgaatgaggatccatgggaacgt
ttactcaaactgcgtgaaaaaatcccgaatcttctgttccagatgctgttccgcggtgcc
aacgctgttggctacacgaactatccggacaacgttatccagaagtttattgaaactgcg
gcacgtgccggcattgacgtgttccgcattttcgacagtctcaactgggtggaagggatg
cgcctggcgatcgaaacggtgcgcgaaacaggcaaaatcgcggaagcggccatttgctat
accggcgatattttgaacccgaaacgtgataaatataatctgaagtactacgtgaatcta
gcaaaagaactggaaaaagccggggctcacatcctggcaattaaagatatggctggtctt
ctgaaaccatatgccgcgtacgaattgatcaaagcgttgaaacaagaaatcggcattccg
attcacctgcatacgcatgatactagcggcaacgcgggcgcgatgctgctgaaagcctcc
gaagccggtgtcgacattgtcgatgtggcgctaagttccatgtccggtctaacctcacag
ccgagcctgaacgccattgcatacgcgctcgaacaccatgagcggacgcctggtctttgt
cacgaaaactatcagaagctcgccgattactgggaagatgtacgcaagtactatgttgga
tttgaaacggagatgaaagcaagcaacgccgaagtatacaagcatgaaatgccgggcggt
cagtacaccaatctggaacaacaggcgaaagccgtcgggcttggcgaccgctggggcgaa
gtgaaagagatgtacgccacggtcaaccgtatgttcggggatatcgtcaaggtaacgccg
tcttccaaagtagtgggcgatatggcattgttcatggtgcaaaacaacctgaacgaacag
aatgtatacgaaaaaggcgaaaccattgactttcctgaatcagtcattacgttcttccag
ggttatctcggccagccgtacggcggatttcccgaggagttgcagcgcatcatcctgaaa
ggccgcgaagctttcaccacccgtccaggcgaattgctgccatccgctgattttgacgag
attagagcgatgctggaagaaaagctggagcgctcggtaaccgactatgatttaatgtcg
tacgtgatgtatccgcaagtcttccttgatatgcaaaaacgccagcaagaattcggtgac
gtgtctgtgctggatacaccaaccttcttctatggtctacgcctgggtgaagaaatcgcc
gtcgacattgaacaaggaaaaacgctgatagtgaagcttgtatccatcggagaagtcaga
ccggacggtatgcgtaccatctactacgagttaaacggccagccgcgcgaaattaatgtg
cgcgacgcatcggcaaaagtgaccacagtccagcgtgccaaggctgatccgtccgaacta
ggacaaatcggcgcttccatgccaggcaaagtgctgaaaatcatggtggagcaaggcgac
aaagtgaaaaaaggtgaacatgtcatcgtcaccgaagcaatgaagatggaaacgaccatg
caggcaccgttcgatggcgtagtcaaagagatccatgttaaagaaggcgattcgatcgaa
acgggcgatttgctgctcgtcattgttaaaaaataa

DBGET integrated database retrieval system