KEGG   Aneurinibacillus sp. XH2: ACH33_18320Help
Entry
ACH33_18320       CDS       T04247                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx00450  Selenocompound metabolism
anx00970  Aminoacyl-tRNA biosynthesis
anx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ACH33_18320
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACH33_18320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:anx01007]
    ACH33_18320
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:anx03016]
    ACH33_18320
Enzymes [BR:anx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ACH33_18320
Amino acid related enzymes [BR:anx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ACH33_18320
Transfer RNA biogenesis [BR:anx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACH33_18320
 Prokaryotic type
   Other AARSs
    ACH33_18320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f NPR1_interact DUF2724
Motif
Other DBs
NCBI-ProteinID: AMA74832
UniProt: A0A0X8D680
Position
complement(3648172..3650166)
Genome map
AA seq 664 aa AA seqDB search
MSKMSKPTYYITSPIYYPSNTLHIGNAYTTIACDALARYKRLRGYDVFYLTGTDEHGQKL
QQRAAQEDKQPLEFIDPIVDWIKDLWERLDISYDDFIRTTQKRHKDAVQKIFQKLVDKGD
IYLGEYEGYYCVPCEAFWTEHQSKKDGEHICPDCGRPISLVKEKSYFFRMSKYQDRLLKY
IEEHPEFIQPESRRNEMVNNFLKPGLEDLSVSRTSFDWGIKLPNDPEHVIYVWIDALTNY
ITALGYMSEDDTKFNKYWPADVHMIGKDILRFHTIYWPIILMALDLPLPKKVFGHGWLLM
PDGKMSKSKGNVIDPKFLIERYGSDSIRYFLLREIPFGQDGVFTPEAFIQRLNFDLANDL
GNLVSRTVAMIEKYFEGVLPAPTAPEMVDENLRNVARQAVTGLEEHMDEMRFGGALNSLW
DLVSRTNKYIDETTPWVLAKDEANKERLGTVMYNLAESIRIISIALQPFMTHAPRKIWAQ
LGITGNEDITSWESAKEWGALPAGIKVNKGDALFPRLDLEKEIAVIDETTAAARKQAEEN
KKKKEQAQAKTEEKPAVPEINIDDFMKVELRVAQVIEAEKIPKADKLLKLQLDLGYEKRQ
VVSGIAKHYSPEDLIGKKVICVTNLKPVKLRGEMSNGMILAASEGDKLTLATVPDSMPNG
AIVK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatgagtaaaccaacgtattacattacatcaccgatttattacccgagcaat
acgcttcatatcggaaatgcttatacgacaatcgcctgcgacgcgctggcccgttataag
cgtttacgtggatacgacgtgttttatctcacaggcacggacgagcatggacagaagctg
cagcaacgcgccgcgcaggaagacaagcaaccgttggaatttattgatccgattgttgat
tggattaaggacttatgggaacgccttgatatttcctatgacgatttcattcgtactacc
cagaagcgtcataaagatgccgtgcagaagatcttccaaaagcttgttgataaaggcgat
atctacctaggcgaatacgaaggttactactgtgtgccttgtgaagcgttttggacggag
catcagtcgaaaaaggatggagaacatatttgtccagattgtggacgcccaatttcgctt
gtgaaagaaaaaagttatttctttcgtatgtcgaaataccaagatcggcttttgaaatac
atcgaagagcatccggagtttattcagccagagtcccgccgcaatgagatggtaaataac
ttccttaagccgggtctggaagacttgagcgtatcccgcacatcattcgactggggcatt
aagttgccgaacgaccctgagcacgttatctatgtctggattgatgcgctgacgaactat
attaccgcgctaggatatatgagcgaagatgacacgaaatttaacaaatattggccggct
gatgtccatatgatcggtaaggacattcttcgctttcacacgatttattggccaattatt
ctaatggcgcttgacttgccattaccgaagaaggtatttggtcatggttggctgcttatg
ccagatggaaaaatgtcgaaatcgaaaggcaatgttatcgatccaaaatttttgatcgaa
cgttacggttccgactcgattcgctacttcctgttgcgtgaaattccgttcggtcaagat
ggcgtattcacgccggaagcatttatccagcgtttgaactttgatctagcgaatgacctt
ggcaatttggtgagccggacggtagcgatgattgagaaatattttgaaggcgtgcttccg
gctccgaccgcgccggaaatggtggatgaaaacctgcgcaatgtggcgcgtcaagcagtt
actggtctcgaagagcacatggacgaaatgcggtttggcggtgcgttgaacagcctatgg
gatctggtgagccgcacaaataaatatattgatgaaacaacgccatgggtgctggcaaaa
gatgaagccaataaagaacgccttggtacagttatgtacaatctggcggaaagcattcgt
attatttctattgctttgcaaccgtttatgacacatgcaccgcgcaaaatttgggcgcag
ctgggtattacgggaaatgaagatattacaagctgggagtcggcaaaagagtggggagcg
cttccggccggcataaaagtaaacaagggtgatgcgttattcccacgccttgatctggaa
aaagaaattgccgttattgatgagacaacggcagcagcgcgtaaacaggcggaagaaaat
aagaaaaagaaggaacaggcgcaagctaaaacagaagagaagccagccgtacccgaaatc
aatatcgatgactttatgaaagtggaattacgcgtggcgcaggttatcgaagcggaaaaa
attccgaaagcagataaattgttgaagctgcaactggatctcggctatgaaaaacgccag
gtcgtatccggtattgccaagcattacagtccggaagaccttatcggcaagaaagtgatc
tgcgtcactaaccttaaaccggtaaagctgcgtggtgaaatgtcgaatggaatgattttg
gccgcatctgaaggagacaaactcactcttgcgaccgttcctgacagcatgccgaacggg
gcgattgtaaaatag

DBGET integrated database retrieval system