KEGG   Azoarcus olearius: dqs_0856Help
Entry
dqs_0856          CDS       T04423                                 

Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
aoa  Azoarcus olearius
Pathway
aoa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:aoa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    dqs_0856
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aoa01007]
    dqs_0856
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aoa03016]
    dqs_0856
Enzymes [BR:aoa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     dqs_0856
Amino acid related enzymes [BR:aoa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   dqs_0856
Transfer RNA biogenesis [BR:aoa03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    dqs_0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1 vWA-TerF-like
Motif
Other DBs
NCBI-ProteinID: ANQ83924
Position
883661..885748
Genome map
AA seq 695 aa AA seqDB search
MTANTLLVELLTEELPPKALPRLGETFATKIAEGLKARGLAAADGAFRWFASPRRIAITM
AGVAAEAAAKEVTEKLMPVAVALDADGKPTPALLKKMEAKGIPASAVPAFERRMDGKAEA
LFHTAVVPGARLAEVLAAIVHDAVKALPIPKVMRWGDGDATFVRPVHKLVMLHGAEVVPG
RVLDLDAGRSTRGHRFMSRGEIDIATADAYEPTLLAEGKVVPDFAERRADIERQLLAEAA
RLGAQLDDYTDLLDEVTALVEHPTVYVGEFEAEFLAVPQECLILTMRANQKYFPLFDAAG
KLQNRFLIVSNMRMEDPVNIVTGNARVVRPRLSDARFFFETDKKHKLDSRLPRLANVVYH
NKLGSVLERVERLEALAGKIAARLRSDEAAARRAARLAKADLVSEMVGEFPELQGIMGRY
YALHDGEGAVVADAVQAHYQPRFAGDALPAGNVAAAVALADKLDALVGFFGIGMVPTGDK
DPFALRRAALGVLRILMEAPLPLDLAALVADAAAGFKPGLLTADGFQAQLLDFMRERLKN
LLRESGGEVAAIDAVLALAPTRIDLVPAKLAAVEAFRALSEAEALAAANKRIVNILKKAE
GAPGEPDVALLQEDAEKALFHRVIEIAPLVKSHVANEDYTDALCVLAGVRAEVDAFFDGV
MVMAEEPLTRQNRLALLAQLAGLMNQVADISRLSA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacaccctgctcgtcgaactgctcaccgaggaactgccgcccaaggcgctg
ccgcggctgggcgaaaccttcgccaccaagatcgccgagggcctcaaggcgcgcggcctc
gccgccgccgacggcgccttccgctggttcgccagcccgcgccgcatcgccatcaccatg
gcgggcgtcgccgccgaagcggccgcgaaggaagtcaccgaaaagctgatgccggtcgcg
gtcgccctcgacgccgacggcaagccgacgccggcgctgctgaagaagatggaagctaag
ggcatccccgcgagtgcggtccctgccttcgagcgccgcatggacggcaaggccgaggcg
ctgttccacactgccgtggtgccgggcgccaggctcgccgaggtgcttgccgccatcgtg
catgatgcggtcaaggcactgcccattcccaaggtgatgcgctggggcgatggcgatgcc
accttcgtgcgtccggtgcacaagctggtgatgctgcacggcgccgaggtggtgccgggc
cgcgtgctcgacctcgatgccggccgcagcacccgcggccaccgtttcatgagccgcggc
gagatcgacatcgccaccgccgacgcctacgagcccacgctgcttgccgaaggcaaggtg
gtgccggacttcgccgagcgtcgcgccgacatcgagcgccagctgctcgcggaagctgcc
cgcctgggcgcccagctcgacgactacaccgacctgctcgacgaagtcaccgcgctggtc
gagcacccgacggtgtatgtcggcgagttcgaggccgaattcctcgccgtcccgcaggaa
tgcctgatcctgacgatgcgcgccaaccagaagtacttcccgctgttcgatgccgccggc
aagctgcagaaccgcttcctgatcgtctcgaacatgcgcatggaagacccggtgaacatc
gtcaccggcaacgcccgcgtggtgcgcccgcgcctgtccgacgcgcgcttcttcttcgag
accgacaagaagcacaagctcgattcgcgcctgccgcggctggccaacgtggtctatcac
aacaagctcggcagcgtgctcgaacgcgtcgaacgcctcgaagcgctcgccggcaagatc
gccgcgcgcctgcgttcggacgaagcggcggccaggcgcgccgcgcgtctggccaaggcc
gacctcgtctccgagatggtgggcgagttccccgagctgcagggcatcatgggccgctat
tacgcgctgcacgatggcgaaggcgcggtggttgcggacgcggtgcaggcccactaccag
ccacgcttcgccggcgatgcgctgccggcgggcaatgtcgccgccgcggtggcgctggcc
gacaagctggacgccctggtcggcttcttcggcatcggcatggtgccgaccggtgacaag
gacccgttcgcgctgcgccgcgccgcgctcggcgtgctgcgcatcctgatggaagcgccg
ctgccgctggatctggccgcactggtggccgacgccgctgccggcttcaagccgggcctg
ctcaccgccgacggattccaggcacagctgctcgacttcatgcgcgaacgcctgaagaac
ctgctccgcgagagcggcggcgaagtcgccgcgatcgacgcggtgctcgcgctggcgccc
acccgcatcgacctggtgcccgccaagctcgccgcggtcgaggccttccgcgcactgtcc
gaagccgaggcgctggctgcggccaacaagcgcatcgtgaacatcctgaagaaggccgaa
ggcgcgccgggtgagcccgatgtcgcgctgctgcaggaggacgccgagaaggcgctgttc
caccgcgtgatcgagatcgcgccgctggtgaagtcccacgtcgccaacgaggactacacc
gacgcgctgtgcgtgctcgccggcgtgcgggccgaggtcgacgccttcttcgacggtgtc
atggtgatggccgaggagccgctgacgcggcagaaccgcctcgcgctgctggcgcaactg
gccggcctgatgaaccaggtcgccgacatttcccgcctgtcggcctga

DBGET integrated database retrieval system