KEGG   Azoarcus olearius: dqs_0971Help
Entry
dqs_0971          CDS       T04423                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
aoa  Azoarcus olearius
Brite
KEGG Orthology (KO) [BR:aoa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    dqs_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ANQ84039
Position
complement(1004143..1004526)
Genome map
AA seq 127 aa AA seqDB search
MSKSETYRIEVEAVAEYVEAQSNPEDDHYVFAYNITIRNTGTVAARLVSRHWVITDGTGH
VQEVHGQGVVGEQPLLAPGESFRYTSGSVLETAVGTMHGSYQMEASDGHRFDAPIPAFML
AMPRVLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaatcggaaacctaccgcatcgaggtcgaagccgtcgccgaatacgtcgaggcc
cagtccaaccccgaggacgatcactacgtcttcgcctacaacatcaccatccgcaacacc
ggcacggtcgctgcccgcctcgtcagtcgccattgggtcatcaccgacggtaccgggcac
gtgcaggaagtgcatggtcagggcgtggtcggcgaacagcccctgctcgcgccgggcgaa
agcttccgctacaccagcggctcggtgctcgaaaccgcggtcggcaccatgcacggcagc
taccagatggaagcatcggacgggcatcgtttcgacgcgccgatccccgctttcatgctg
gcgatgccgcgcgtgcttcactga

DBGET integrated database retrieval system