KEGG   Azoarcus olearius: dqs_2429Help
Entry
dqs_2429          CDS       T04423                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
aoa  Azoarcus olearius
Pathway
aoa00790  Folate biosynthesis
aoa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    dqs_2429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aoa04147]
    dqs_2429
Enzymes [BR:aoa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     dqs_2429
Exosome [BR:aoa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   dqs_2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ANQ85459
Position
2588619..2588972
Genome map
AA seq 117 aa AA seqDB search
MLNELSTRKCTPCQGGMPALDRSEAERYLSQAPGWSLADNGSRIERHYSFRDYRSALRFV
VDLSQLAEDEGHHPDISFGWGHATVSWQTKKIKGLHENDFIMAAKTDQIAGDGNGSA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacgaactctccacccgcaagtgcacgccctgccaaggcggaatgccggccctc
gaccgcagcgaggccgagcgttacctgagccaggcgccgggctggtcgctggccgacaac
ggcagccgcatcgaacgccactacagcttccgcgattaccgcagcgcgctgcgcttcgtg
gtcgacctcagccagctcgccgaggacgaaggccaccatccagacatctccttcggctgg
ggccacgcgaccgtgtcctggcagaccaagaagatcaagggcttgcacgaaaacgacttc
atcatggcggccaagaccgaccagatcgcgggcgacggtaacggttcggcctga

DBGET integrated database retrieval system