KEGG   Acholeplasma oculi: Aocu_06470Help
Entry
Aocu_06470        CDS       T03695                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aoc  Acholeplasma oculi
Pathway
aoc00071  Fatty acid degradation
aoc00072  Synthesis and degradation of ketone bodies
aoc00280  Valine, leucine and isoleucine degradation
aoc00310  Lysine degradation
aoc00362  Benzoate degradation
aoc00380  Tryptophan metabolism
aoc00620  Pyruvate metabolism
aoc00630  Glyoxylate and dicarboxylate metabolism
aoc00640  Propanoate metabolism
aoc00650  Butanoate metabolism
aoc00900  Terpenoid backbone biosynthesis
aoc01100  Metabolic pathways
aoc01110  Biosynthesis of secondary metabolites
aoc01120  Microbial metabolism in diverse environments
aoc01130  Biosynthesis of antibiotics
aoc01200  Carbon metabolism
aoc01212  Fatty acid metabolism
aoc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aocu_06470 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    Aocu_06470 (fadI)
   00640 Propanoate metabolism
    Aocu_06470 (fadI)
   00650 Butanoate metabolism
    Aocu_06470 (fadI)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Aocu_06470 (fadI)
   00072 Synthesis and degradation of ketone bodies
    Aocu_06470 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aocu_06470 (fadI)
   00310 Lysine degradation
    Aocu_06470 (fadI)
   00380 Tryptophan metabolism
    Aocu_06470 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aocu_06470 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Aocu_06470 (fadI)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Aocu_06470 (fadI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aoc04147]
    Aocu_06470 (fadI)
Enzymes [BR:aoc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Aocu_06470 (fadI)
Exosome [BR:aoc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aocu_06470 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDR30720
UniProt: A0A061A9Z9
Position
1:714963..716171
Genome map
AA seq 402 aa AA seqDB search
MKKVYVVAANRSPIGSFLGTLSKISPAEFGAQVLSKMLAKHQIDPSIIDEVIIGNVLPAG
QKQGLARQVSILSGIHESVPAYSVNMICGSGMKSVINAFSNIQAGIADVVVAGGVESMSQ
APFLVDGSIRQGVKMGNMNLVDYMLTDGLTDAFGNYHMGITAENIVEKHQFTRQMQDEFA
YNSQLKAREALKQGKFKEEIIPIVIKDRKGEIVFSEDEYINHTTTLEKIAALKPAFKKDG
TVTAASSSGINDGASFIVIASEDAIKKHHLTPLFEVIGVGQAGVDPSVMGLGPVPAIEKS
LVFAGIRIQDIDIFELNEAFAAQALGVVREVSEKYQVTEDSILDKTNPNGGAIALGHPVG
ASGNRIMVTLMHEMLRNKDQKIGLASLCIGGGMGTSVILRKV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatatgttgtagctgcaaatagaagtccaattggttcttttttaggaacc
ttatcaaaaattagtcctgctgagtttggggcacaagtattaagtaaaatgttggctaag
catcaaattgatccttcaataatcgatgaagttatcattggtaatgtattaccagctggc
caaaaacaaggtctagcaagacaagtctctattttatcaggtattcatgaatcagttcct
gcttatagtgtaaatatgatatgtggatccggtatgaagagcgtaataaatgctttttca
aatattcaagcaggtatagcggatgttgtagttgcaggtggtgtcgaatcaatgagccaa
gcaccttttttagtggatggttcaattagacaaggggttaagatgggcaacatgaatttg
gttgattacatgttaacagatggccttactgacgcattcggaaactatcatatgggaatc
actgctgaaaacattgttgaaaaacatcagtttacaagacaaatgcaagatgaatttgca
tataactctcaacttaaagcaagagaagcattaaaacaaggtaaatttaaagaagaaatt
attcctatcgtcatcaaagatcgtaaaggcgaaatcgtattttctgaagatgaatacatt
aaccacactacaacattagaaaagatagcagcattaaaacctgcatttaaaaaagatgga
acagtaactgcagcatcttcatcaggtattaatgatggagcatcatttattgtcattgca
agtgaagatgcaattaagaaacatcatctgactcctttgtttgaagtgattggagttgga
caggcaggtgttgatccaagcgtcatgggattaggacctgttcctgcgattgaaaaatca
ttagtttttgctggaatacgcattcaggatattgatatttttgaactgaatgaagccttt
gctgctcaagctttaggggtagtcagagaagtcagtgaaaaatatcaagtaactgaagac
tcaatacttgataaaacaaatcctaatggtggtgcaatagcattaggtcacccagtagga
gcatcaggtaatagaattatggtaacactgatgcatgaaatgttaagaaataaagatcaa
aaaattggacttgcaagtctatgtattggtggcggaatgggaacttcagtcatcttaaga
aaggtataa

DBGET integrated database retrieval system