KEGG   Acholeplasma oculi: Aocu_07950Help
Entry
Aocu_07950        CDS       T03695                                 

Definition
(GenBank) Glycosyl hydrolase, family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
aoc  Acholeplasma oculi
Pathway
aoc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Aocu_07950
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Aocu_07950
Enzymes [BR:aoc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Aocu_07950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: CDR30868
UniProt: A0A061AAK4
Position
1:complement(884998..886440)
Genome map
AA seq 480 aa AA seqDB search
MSLLKKILTILMVSCLFIITACNPPIEIEEEPVKKLYDVKHFITAGNKSKLLNEELETST
EFDLNVSGLKVTINPEKTFQVMDGFGAAMTESSAIVIANLEPSKRTEVMNQLFGPDGIGI
SFIRIAMGASDFSLNDFTYNDTLGNVTDLDLVNFTIERDETYLIPILKEALALNPDLLIM
ASPWSAPAWMKDNKNLNGGRLLSQYHEVYANYFVKFIDAYKAHGIDIYAVTPQNEPLHET
NGYPSMYMPASQQIEFVYKLGQAFERESIDTLIFAYDHNWDRMDYPISVLNSKAAKYTAG
AALHGYGGNVSETSRLERLFPDKGIWFTEISGGLWATSFPDNITWNMENIFMGMINRSAK
GVLMWNIALDQDNGPKNGGCQNCRGVLTSNTETNTVTMNEEYYIIGHFSKFVERDALRIE
SISNNGNIIVSSFKNPDGSIAVIVHNKNTFNASIFLNIHESSQQYNIPAKGIASFILTEK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgtcattgttgaaaaaaatactaacgatattaatggtgagttgtctttttataataaca
gcttgcaacccacctatagaaatagaggaagaacctgtgaaaaaactatatgatgtgaag
catttcataacagctggaaataaatcaaaattacttaatgaagaattagaaacatctaca
gaatttgatttaaatgtaagtggattaaaagtcactattaatcccgaaaagacttttcag
gtaatggatggttttggtgcagcaatgactgaatctagtgcaattgttattgcgaatctt
gaaccctctaaaagaactgaggtcatgaatcaattatttggaccagatggcataggtatt
tcatttataagaattgcaatgggggcatcagatttttcgctgaatgattttacatataat
gacactttagggaatgttacggatttagatttagtcaattttacgattgaacgcgatgaa
acttacttaataccgattctaaaagaagcacttgctcttaatcctgatttactgattatg
gcaagtccatggtcagctcctgcttggatgaaagacaataaaaacttaaatggtggacgc
ttattaagtcaataccatgaagtttatgcaaattattttgttaaatttatagatgcatat
aaagcacatggtatagatatatatgcggtaaccccacaaaatgaacctttacatgaaaca
aatggttatccttcaatgtatatgcctgcgagtcaacaaattgaatttgtttataagtta
ggacaagcatttgaaagagaatctatagatacgctgatatttgcatatgatcataactgg
gatagaatggattatccaattagtgtattaaatagtaaagcagcaaaatacacagctggt
gctgcattacatggttatggtggcaatgtaagtgaaacctcaagattagaaagattattt
cctgataagggcatttggtttactgaaatatcaggtggattatgggctacaagcttccct
gataatattacatggaatatggaaaacatattcatgggtatgattaaccgaagtgctaaa
ggtgtattgatgtggaatatcgcactggatcaagataatggacctaaaaatggtggttgt
caaaattgtagaggtgttttaacatccaatacagagacaaatacagtgaccatgaatgaa
gagtactatatcataggacatttttcaaaatttgttgaacgtgatgctctgagaattgag
agtatttcaaacaacggaaatataatcgtttcaagttttaaaaatccagatggatcgatt
gcagttattgtacataataaaaatacatttaatgcatccatattcttaaatattcatgag
tcaagccaacaatataacataccagcaaaaggtattgcatcgtttattctaactgaaaaa
taa

DBGET integrated database retrieval system