KEGG   Acholeplasma oculi: Aocu_13640Help
Entry
Aocu_13640        CDS       T03695                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
aoc  Acholeplasma oculi
Pathway
aoc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aoc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Aocu_13640 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aoc03011]
    Aocu_13640 (rplV)
Ribosome [BR:aoc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Aocu_13640 (rplV)
  Bacteria
    Aocu_13640 (rplV)
  Archaea
    Aocu_13640 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CDR31437
UniProt: A0A061AK78
Position
1:complement(1475936..1476271)
Genome map
AA seq 111 aa AA seqDB search
MEAKAIAKTVRIAPRKVRLVIDLIRGKNVKEARAILMFTPRGASPVIAKVLNSAVANATH
NLKLNEETLYVKEVWANESVTMKRMLPRAKGTGNIFNKRTSHITVVVAERE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagcaattgcaaaaactgtcagaatcgctcctagaaaagttcgtcttgtt
atcgatttaattcgtggcaaaaacgttaaagaagctagagctattcttatgtttacaccg
cgtggtgcatctccagttattgctaaagtattaaactcagcagtagcgaatgcaacacac
aatttaaagttaaacgaagaaacactatacgttaaagaagtatgggctaatgagtccgta
acaatgaagagaatgttacctcgtgctaaaggtactggtaacatcttcaacaagcgcaca
tcacacattactgttgttgttgcagaaagggagtaa

DBGET integrated database retrieval system