KEGG   Amphiprion ocellaris (clown anemonefish): 111564646Help
Entry
111564646         CDS       T06018                                 

Gene name
dusp10
Definition
(RefSeq) dual specificity protein phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111564646 (dusp10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aoce01009]
    111564646 (dusp10)
Enzymes [BR:aoce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111564646 (dusp10)
    3.1.3.48  protein-tyrosine-phosphatase
     111564646 (dusp10)
Protein phosphatases and associated proteins [BR:aoce01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    111564646 (dusp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 111564646
NCBI-ProteinID: XP_023120116
Ensembl: ENSAOCG00000018952
Position
Unknown
AA seq 472 aa AA seqDB search
MPPSPLDDRIVVALPRPIRPQELQLRLDTSYLDSIATSSSSKTVISTTVVKIRATANLVT
YMPSSKGSTRSLSCGCSSASCCSVTTYEKDSPSLSHSQVSASSPNLSYAGPPTSIVSNHE
AVSAPTPTPGTPKALSTVRLIHPNELAKRMTCCSMGHPVGPMPIIIDCRPFMEYNKSHIR
GAVHINCSDKISRRRLQQGKITVLDLISCREAQDSLKGIFSKEIVVYDESTTDANRLTSS
QPLHVVLGSLRREGKDPIILKGGLSCFRQSHENLCEHSLHLHEGLDTGAAAGMTGVLPHS
LPTTPDIENAELTPILPFLYLGNEQDAHDINLLQRLNIGYILNVTTHLPLYHYETGLFIY
KRLPATDSNKQNLRQYFEEAFEFIEEAHQAGMGLLIHCQAGVSRSATIVIAYLMKHTWMT
MTDAYKFVKTRRPIISPNLNFMGQLLEFEEDLNNGITPRILTPKLIGVETIV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatctcctcttgacgacagaattgtggtggcgctgccaaggccaatccgacct
caggaactccaactgcgcctagacactagctacctggactccattgctaccagcagcagc
agcaagacagttatcagcaccaccgtggtgaagattcgggcaacggccaatcttgtaacg
tatatgccctcatccaagggctccacgcgctctttgtcgtgtggatgcagcagtgccagc
tgctgctctgtgactacctatgagaaggacagcccgagcctcagccacagccaggtgagt
gccagcagccccaacctcagctatgctgggccccccacctctatagtcagcaatcatgaa
gcagtaagtgcccccactcccaccccgggcacgccaaaggccctgtccaccgtgaggctc
atccaccccaatgagctggccaaacggatgacctgctgctccatgggtcaccctgtaggg
cctatgccaatcattattgactgccggcccttcatggagtacaacaagagccacatccgg
ggggctgtgcatatcaattgctctgacaagatcagccggcggcggctgcagcagggcaag
atcactgtgctggacctcatctcctgccgggaggcccaggattctcttaagggcatcttc
tccaaagagattgtggtttacgatgagagcaccacagacgccaaccggttgacttcctcc
cagcctctgcatgtggttctgggttcactgaggagggagggcaaggaccccatcatcctc
aaaggaggccttagctgctttaggcagagccacgaaaacctgtgtgagcactcactgcac
cttcatgagggcttggacacaggtgcagctgctggcatgacaggggttctacctcattcc
ctgcccaccaccccagatatagagaatgccgagctgacaccaatcctgccttttctctat
ctggggaatgagcaagatgctcatgacattaacctgctgcagcgcttgaacatcggctac
atcctcaatgtgaccacccacctgccactgtatcactatgaaacggggctcttcatctac
aagcgtctgcctgccactgacagcaacaagcagaacctgcggcagtattttgaggaggct
tttgaatttattgaggaagcacaccaagcaggtatgggccttctgatccactgccaggca
ggcgtatctcgttcagccaccattgtgattgcctacctgatgaagcacacctggatgacc
atgacagatgcttacaaatttgtcaaaaccaggaggcccatcatctccccaaacctcaac
ttcatgggccagctgttggaatttgaggaggatcttaacaatggaataacgccacgaatt
ctcacgccaaagctgatcggtgtagaaaccattgtctaa

DBGET integrated database retrieval system