KEGG   Amphiprion ocellaris (clown anemonefish): 111564801
Entry
111564801         CDS       T06018                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aoce01002]
    111564801
Enzymes [BR:aoce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     111564801
Peptidases and inhibitors [BR:aoce01002]
 Metallo peptidases
  Family M1
   111564801
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 111564801
NCBI-ProteinID: XP_023120364
Ensembl: ENSAOCG00000012761
Position
Unknown
AA seq 941 aa
MLAPLLLLLLVFALVPPSFGAQLPNQNQAKEPPVATNGQPFPWDRMRLPKTVTPLHYDLS
IHPNLTTLDFSGVVRIELDVHEDTSTVILHSKQLQISGALLMAPEGVKPLQVLEYPRFHQ
LALLSDSVLTKGRKYEVQLEFAANLSDSFHGFYKSSYKTSSGEVRVLASTQFEATFARGA
FPCFDEPAFKANFTIRIVREPRHITISNMPKVKTVELPGGLLEDHFDTTVKMSTYLVAYI
VSDFLSVSKTTKHGVEISVYAVPEKIDQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAA
IPDFQSGAMENWGLTTYRETGLLFDPDRSSASDKLGITKVIAHELAHQWFGNLVTMEWWN
DLWLNEGFAKFMEYISLDITYPELQVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQ
EMFDDVSYDKGACILNMLRDFLTPEAFEIGIIRYLKRYSYQNTVNSHLWESLTNICESDD
LVEGRMEHREFCSKRKLQSGTSKWHSGDELDVRAIMDTWTLQEGFPLVTVEVRGREVRLS
QERFLKTNDPSLTEGFLWQIPLTYMTSASSTIHRFLLKTKTGVLYLPEEVDWVKFNVDMS
GYYMVHYAGDGWNSIIKVLQHNHTALTSNDRASLIQNVFQLVSVGKVRLDTALELSLYLS
RETEIMAVTQGFGELVPLYKLMEKRDMAALENQMKGYIVDLFRGLIDRQEWTDSGSVSER
VLRSYLLLFACVRKYPPCLNKATQLFNQWKDSDGNMSLPVDITMAVFITGAQTAEGWDFL
FEKYRHSMQMSVRSRMKTAMAWSPRKDKLQWMMEQSLHGEVMKTQDLPDVVVSISKNPHG
YKLAWHFLRAHWHTMIKKFDLGSSTISYLVTGVTNQYSTTEMLDEIRSFFGSLTEETGSE
MRCIQQTYETIEDNIRWMDKNLPLLQAWLNKRNHRVPHEDL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgttggctcccctcctcctcctcctgctggtcttcgccctcgttcctccctcatttggg
gctcagctaccaaatcaaaaccaagccaaggagcctcccgtagccaccaacggccagcca
ttcccctgggaccgcatgaggcttcccaaaaccgtcactcccctccactatgacctgagc
atccacccaaacctgaccaccctggacttcagcggcgtcgttcgtattgagctggatgtg
catgaagacaccagcaccgtgattctccactccaagcagctacagatatccggcgcgctg
ctcatggcccctgaaggagtgaagccccttcaggttctggagtatccccgctttcatcag
ctcgctctgctgtcagactcggtgctgaccaaaggcaggaagtatgaagttcagctggag
ttcgctgccaacttgtctgacagcttccatggtttctacaagagtagctacaaaaccagc
agcggggaggtccgggtcctggcgtcgacacagtttgaagccacctttgctcgtggagct
ttcccctgtttcgatgaaccggccttcaaagccaactttactatacggatcgtacgggag
ccgcgacacataaccatctccaacatgcccaaggttaaaactgttgagctgccaggcggt
ttgcttgaggatcactttgacaccactgttaaaatgagcacctacttggtggcttacatt
gtgtctgacttcttgtctgtgagcaaaaccaccaagcatggtgtcgagatttcagtctat
gctgtccccgaaaagatcgaccagacagcctttgcgttggacgctgctgtcaagctgtta
gacttttatgatgactattttgatattccttacccacttcccaaacaggacctggctgct
atccctgacttccagtcaggtgcgatggagaactggggtctgaccacctacagagagact
ggcctcctctttgatcctgacaggtcctctgcctccgacaagctgggcatcactaaggtc
atcgcccatgagctggcgcaccagtggtttggcaacctggtgacgatggagtggtggaac
gacttgtggctcaacgagggtttcgcaaagttcatggagtatatttccctcgacatcacc
tacccagaactgcaagtggatgacttcttcttggggaaatgtttcgaggcgatggaggtg
gactccctcagctcctctcacccagtctccacccccgtagaaaaccccacacagatccag
gagatgttcgacgatgtgtcatatgacaagggagcctgtattctgaacatgctgcgggac
tttcttactcctgaggccttcgagatcggcatcatccgatacctcaaacgttacagctac
caaaacactgtgaacagccacctgtgggagagtctgaccaatatctgcgaatcagatgac
ctggtcgaaggtcgaatggaacacagagaattctgctccaaacgtaaacttcagtctgga
acctctaagtggcactctggtgatgagctggacgtcagagccatcatggacacctggacg
ctgcaggaaggattcccactggtcactgtggaggtcagaggtcgggaggtccggctgagt
caggagagattcctgaagacgaacgatccctccctcactgaaggcttcctgtggcagatc
cctctgacctacatgaccagcgcctccagcaccatccaccgcttcctgctcaagacaaag
actggtgtgctgtacctgccggaggaggtggactgggtcaagttcaacgtggacatgagt
ggctactacatggttcactatgcaggcgacggctggaactccatcatcaaagtcctgcag
cacaaccacacggctctgaccagcaacgatcgcgccagcctcatccaaaacgtcttccag
ctggtcagcgtggggaaggtgaggctggacacggctctggagctgtcgctgtatctgtcc
agagagacggagatcatggctgtgactcagggcttcggagagctcgtacctctttacaaa
ctgatggagaagagagacatggcggctctggagaatcagatgaagggctacattgtcgat
ctgttccgggggctgatcgaccggcaggagtggacggactctggctcagtttctgagcga
gtgttgaggagttacctgctgctgttcgcctgcgtcaggaaataccctccatgtctgaac
aaagccacgcagctctttaaccagtggaaggactccgacggcaacatgagcctcccagtt
gacatcacaatggctgtgttcataaccggagctcagacggcagaagggtgggacttcctg
tttgagaagtaccgccactcgatgcaaatgtctgtcaggagccgcatgaagactgccatg
gcttggagtccacggaaggacaaactccagtggatgatggagcagagcctccacggtgag
gtgatgaagactcaggacctcccagatgtcgtcgtgtccatcagcaagaacccacacggc
tacaaactggcctggcatttcctccgagcccactggcacaccatgatcaagaagtttgac
ctcggctccagcactatatcatacttggtgactggagttaccaaccagtactctaccaca
gagatgctagatgagatacgaagcttcttcggctccctgaccgaggagacgggctcagag
atgaggtgcatccagcagacctacgagaccatcgaggataacatccgctggatggacaaa
aaccttcctctgctgcaggcctggctgaacaaacgcaaccacagagtgcctcatgaggat
ttatag

DBGET integrated database retrieval system