KEGG   Amphiprion ocellaris (clown anemonefish): 111565416
Entry
111565416         CDS       T06018                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aoce03000]
    111565416 (ahrr)
Transcription factors [BR:aoce03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111565416 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_9 PAS_3 RLL
Other DBs
NCBI-GeneID: 111565416
NCBI-ProteinID: XP_023121235
Ensembl: ENSAOCG00000008783
Position
Unknown
AA seq 695 aa
MIPPGDCMYAGRKRRKPIQKQKPSSASEKTNPSKRHRDRLNAELDRLASLLPFSPDVISK
LDKLSVLRLAVSYLRVKSFFQATQEKTSRKHNISTSSSNPEPRKESLPLGTSVNESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQGTSTHQENQLATGTGEDFVVSSLFHSQEAGEISSELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSASGALLPPQLALFCIGVPLLLPSITEMKMKNMLMRGKT
KGGGGGIISAMEHSERGEHLRRHSYSGGMGDIADPLLLSCPTPGATQRGHHTPWTPLSKD
NLKYRPDGYYNQEEPLNYCKSSMAPHKGLSPGLGGGWPLRQNSGPIRAGQGVGYIPSNRL
NKTGQYGKPYRLSPNCHSSRNGEVFVSRLYGNVQIPADPDAYCVDLVKSENGYGECYDGH
LMPEMPPIKIEHDSDSENGCDAYGRPWACRDPAAIDRRYGNGVYDPNTGLQLKSEADYYD
PQYSPCQRGKAGISPPYNNGNYQNYAVNNGGNNSTRLLKCDKDLGNNNDSSQFSPQRLSH
SDSLCSNQPVNLMDSHVYSQDPHKAYMHPDYNKHGTYEFKGHGLIHSIKREPMDSPPWSE
SGHDMNQSMMVGPRNVMPCVMSTGHHKSSPYIYMP
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgatccctccgggagactgcatgtatgcgggcagaaagaggaggaagcccatccaaaaa
cagaagccgtcgtctgccagtgagaaaaccaacccgtccaagcggcaccgggacaggctg
aatgctgaactggaccggctggccagcctgctgccgttctcgccggatgtgatctctaag
ctggacaagctgtcagtgctgcgccttgcagtttcctacctccgcgtcaagagtttcttc
caagcgactcaagagaaaacctccaggaagcacaacatcagcacatcatcctctaaccct
gaacccaggaaagagagccttccactgggcaccagcgtcaatgaaagcagcctcctgctg
gaatctctgacaggttttgccctggtggtgagcagtgatgggatggttttttatgcttcc
tccaccattgtggactatctgggatttcatcagactgacgtgatgcaccagaatgtgttt
gactacatccacatagacgaccgtcaggagtttagacgccagctgcactgggccatgtgt
cctccacagcatcaggggacatcaacacaccaggaaaaccagctggctacaggaactggt
gaagactttgtagtgagcagcctgttccattcacaggaggcaggggaaatctcttctgag
ctctcctgctttctcaacagatgtttcatagccagagttcgatgcctcttggacagcacc
tctggattcttgactatgcagttccagggtcgattgaagttcctccatggccagaaaaag
aagtcagcatctggggctctactgcctcctcagctggctctgttctgcataggtgtgcca
ctcttactgccctccatcactgagatgaaaatgaaaaacatgttaatgcgaggaaagacc
aagggtggaggaggagggatcatctctgccatggaacacagtgagcgtggggaacacctc
cggaggcactcctacagtggaggaatgggggacattgcggaccctctcctcctctcctgc
cccacgcctggtgccacccagcgaggtcaccacactccctggactccgctctccaaagac
aacctcaagtaccgccccgatggttactacaaccaggaggagcccctcaactactgcaag
tcctccatggctccacataagggtctgagcccgggcctgggtggtgggtggcccctgcgg
cagaactcaggtcccatcagagcaggccagggtgtcggctacatcccctctaaccgcttg
aacaagaccggccagtacgggaagccataccgcctttccccgaactgtcacagcagcaga
aatggtgaggtgtttgtctccaggctctacgggaatgtccagattccggcagacccagac
gcctactgtgtggatctggtgaagagcgagaacggctacggagagtgctacgatggccac
ctgatgcccgagatgccacccatcaagatagagcacgactcggactccgagaacggctgc
gacgcgtacggacgaccctgggcttgccgcgacccggctgccatcgaccgacgctatggt
aacggggtgtacgacccaaacactggcctgcagctcaaatccgaggcagattattacgac
cctcagtactcgccctgtcagcgagggaaagcgggaatcagcccaccgtacaacaacggc
aactaccagaactatgcagtcaacaacggtgggaacaactccacacgtctcctaaagtgt
gacaaagacttggggaataacaatgactccagccagtttagccctcagagactctctcac
tcagactctctatgcagcaaccaacccgtcaacctcatggactcgcacgtgtattcacag
gacccgcacaaggcctacatgcacccggactacaacaagcatggcacttatgagttcaaa
ggtcacggtttgatccattcgatcaagcgggagcccatggactctcccccctggtccgag
agcggccacgacatgaaccagtccatgatggttggtccaaggaacgttatgccctgtgtg
atgagcacagggcaccacaagtccagcccctacatttatatgccctaa

DBGET integrated database retrieval system