KEGG   Amphiprion ocellaris (clown anemonefish): 111569136Help
Entry
111569136         CDS       T06018                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04060  Cytokine-cytokine receptor interaction
aoce04068  FoxO signaling pathway
aoce04110  Cell cycle
aoce04218  Cellular senescence
aoce04350  TGF-beta signaling pathway
aoce04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111569136 (tgfb2)
   04350 TGF-beta signaling pathway
    111569136 (tgfb2)
   04068 FoxO signaling pathway
    111569136 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111569136 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111569136 (tgfb2)
   04218 Cellular senescence
    111569136 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111569136 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aoce04052]
    111569136 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:aoce00536]
    111569136 (tgfb2)
Cytokines and growth factors [BR:aoce04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111569136 (tgfb2)
Glycosaminoglycan binding proteins [BR:aoce00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111569136 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 111569136
NCBI-ProteinID: XP_023126880
Ensembl: ENSAOCG00000020669
Position
Unknown
AA seq 413 aa AA seqDB search
MNVFLVVLFLTLDLATVALSLSTCSTLDMEQFRKKRIEAIRGQILSKLKLSSPPEDFPEP
GEVSRDIVAIYNSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPFYPSENVISP
THFNPYFRRLTFDVSSMEKNSSNLVKAELRIFRLQNPGARVSEQRIELYQILGHKDLSSP
TQRYIDSKVVRTQTEGEWLSFDVTEAVSEWLNHRDRNSGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDSFLHGGDLKVFKKRRHSAQAPHLLLMLLPSYRLESQSQHKNHRSK
RALDAAYCSRNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYEANFCAGACPYLWSADTQHS
KVLGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMKVKSCKCS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgtttctggtggttctgttcctcactctggacctggccaccgtggctctcagt
ctgtccacatgcagcacgctggacatggagcagttcaggaaaaagcgcatcgaggccatc
cgggggcagattctgagcaagctgaagctctccagccccccggaggacttccccgagccg
ggcgaggtgtcccgggacatcgtggccatttacaacagcacccgggacctgctgcaggag
aaggccaacgaacgcgcagcgacgtgcgagcggcagcgcagcgaggaggaatattacgca
aaggaggtgcacaagatcgacatgcagccgttttacccgtcagagaacgtcatttctccg
acacacttcaacccgtacttcaggcggctgaccttcgacgtgtcgtctatggagaagaac
tcctccaacctggtgaaggctgagctccggatcttccgtcttcagaaccccggagcccga
gtgtcggagcagcgcatcgagctctatcagattttaggacacaaagacttgtcgtctccg
actcagcgctatatcgacagtaaggtggttcggacccagacggagggagagtggttgtcc
ttcgatgtgactgaagcagtgagtgaatggttgaaccacagagacagaaacagtggattc
aagatcagcctccactgtccctgctgcacgtttgtaccgtcaaataactacattattccc
aacaagagcgaggagctggaggctcgatttgcaggtattgatgacagcttcctccacggc
ggcgacctgaaggtgtttaagaagcgacgccacagcgctcaggctccacacctgctgctg
atgctgctgccttcctatcggctcgagtctcagtcgcagcacaagaaccaccggtccaag
agagctctggatgctgcctactgctccagaaacgttcaggacaactgctgcctgcgttcc
ctctacattgactttaagaaggaccttggctggaggtggatccatgagcccaaaggctac
gaggccaacttctgtgcgggggcgtgtccttacctgtggagcgccgacacccagcactcc
aaggtgttgggtctctacaacaccatcaaccccgaagcatcagcgtctccctgctgcgtc
tcccaggacctggagcccctcaccatcctctactacatcggaaagacccccaagatcgag
cagctgtccaacatgaaggtcaagtcctgtaagtgcagctag

DBGET integrated database retrieval system