KEGG   Amphiprion ocellaris (clown anemonefish): 111571726Help
Entry
111571726         CDS       T06018                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111571726
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aoce04030]
    111571726
G protein-coupled receptors [BR:aoce04030]
 Rhodopsin family
  Lipid
   Leukotriene
    111571726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa DUF1345
Motif
Other DBs
NCBI-GeneID: 111571726
NCBI-ProteinID: XP_023130794
Ensembl: ENSAOCG00000016143
Position
Unknown
AA seq 387 aa AA seqDB search
MESTMNSTTSFQPPSSASFSLPVSLSAKIGVAILTLAFILGFPGNLFVVWSVFCKVKKRS
VTCLLVLNLAVADALVLLSAPFFLRYLAGGRGWEFGSAACKLVHYLCNVNMYVSIYLICL
MSMDRWLAVTRPFLSQRMRTKRSLLVFLLLVWVLAFLLALPMPFYRSNLKKVFPNNITLS
FCIPYHWKSVGHPVFQYLFETTMGCLVPFSLISTCYSSIFCRLQSAKFQRRAQGRRLILM
IICAFAIFWLPYHIVNIIEVIGLLQNSDSVLKAASTARPNVTAFAYFSSAINPILYVFAG
SSHIRQAGLSFMGKMFEATNSESRSTSTFTRSGRSSSSPDESSVLQTLSIKLGKPFKGKN
KGRSSSVADKEINEPELKTLASVEQLE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaatccactatgaacagcaccacctctttccagccgccgtcttctgcctccttctca
ctgcccgtctccctctcagccaagatcggcgtcgccatcctgaccttagcgtttattctg
ggctttcccgggaacctgtttgtggtttggtcggtgttctgcaaggtgaagaagcgctca
gtgacatgcttgttggtgctgaatctggctgtggccgatgccttggtgctgctcagcgcc
cctttcttccttcggtacctggctggaggccggggttgggagtttggctcggcagcatgc
aagctggtgcattacttgtgtaatgtgaacatgtacgtgtccatctacctgatctgtctg
atgagcatggaccgctggctggctgtcacgaggccttttctgtcccagaggatgagaacc
aaacgctccttgctggttttcctgctgctggtctgggtgttggcttttctcctggcattg
ccgatgcctttctaccgcagtaatctgaagaaagtattcccaaacaacatcactttgagc
ttttgcatcccttaccactggaagagtgtgggccacccggtcttccagtacctgtttgag
accaccatgggctgcctggtgcccttctccctcatcagcacctgttactcctccatcttc
tgccgcctacaaagtgccaagtttcagcgcagagcacaaggcaggcgcctgatcctgatg
atcatctgtgcctttgcgatattctggctgccctatcacattgtcaacatcatagaggtg
attggtctattgcagaacagcgattcagtgctcaaagctgcttccactgcccgtcccaat
gtcacagcctttgcttacttcagcagcgctataaatccgatcctctacgtgttcgctggc
agctcccacatccgccaggctgggctcagcttcatgggcaagatgttcgaggccaccaac
tcagagagcagaagcacgtctaccttcacccgcagtggccgcagcagctcttcaccagat
gaaagttctgtcctgcaaacgctgtccatcaaactggggaaacctttcaaaggcaagaac
aagggaaggagcagcagtgtggcagacaaagagatcaatgagcctgaactcaagactctg
gccagtgttgagcagttagagtag

DBGET integrated database retrieval system