KEGG   Amphiprion ocellaris (clown anemonefish): 111572498Help
Entry
111572498         CDS       T06018                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce03040  Spliceosome
aoce04010  MAPK signaling pathway
aoce04141  Protein processing in endoplasmic reticulum
aoce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111572498
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111572498
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111572498
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111572498
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aoce01009]
    111572498
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aoce03041]
    111572498
   03009 Ribosome biogenesis [BR:aoce03009]
    111572498
   03110 Chaperones and folding catalysts [BR:aoce03110]
    111572498
   04131 Membrane trafficking [BR:aoce04131]
    111572498
   03051 Proteasome [BR:aoce03051]
    111572498
   03029 Mitochondrial biogenesis [BR:aoce03029]
    111572498
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aoce04147]
    111572498
Protein phosphatases and associated proteins [BR:aoce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111572498
Spliceosome [BR:aoce03041]
 Complex B
  Other components
   Prp19 complex
    111572498
 Complex C
   Prp19-CDC5 complex
    111572498
Ribosome biogenesis [BR:aoce03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111572498
Chaperones and folding catalysts [BR:aoce03110]
 Heat shock proteins
  HSP70 / DNAK
   111572498
Membrane trafficking [BR:aoce04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111572498
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111572498
Proteasome [BR:aoce03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111572498
Mitochondrial biogenesis [BR:aoce03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111572498
Exosome [BR:aoce04147]
 Exosomal proteins
  Proteins found in most exosomes
   111572498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 111572498
NCBI-ProteinID: XP_023131958
Position
Unknown
AA seq 638 aa AA seqDB search
MSAGKGAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPSNTVFDAKRLIGRKFDDPLVQADMKHWPFKVLSDGGKPKIQVEYKGEDKTFYPEE
VSSMVLVKMKETAEAYLGHKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGKSGERNVLIFDLGGGTFDVSVLTIEDGIFEVKATAGDTHLGGEDFDNRMV
NHFVEEFKRKHKKDVSQNKRALRRLRTACERAKRTLSSSSQASIEIDSLLEGTDFYTSIT
RARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDVVLVGGSTRIPKIQKLLQDFFNGRE
LNRSINPDEAVAYGAAVQAAVLSGDTSANVQDMLLLDVAPLSLGIETAGGVMAPLIKRNT
TIPSKQTQVFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIQVTF
DIDANGILNVSAVDKSTGRENKITISNDKGRLSKEEIERMVQDAEKYKAEDEEQRDKIAA
KNSLESLAFNMKSSLQDDSVKGRMSEEEQKKLLEKCEETISWLENNQLADKDEFQHKQKE
LEKVCNPIISKLYQGGRPAGSCREQAGGPQGPTVEEVD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaggtaaaggcgcagcgatcggcatcgacctgggcaccacctactcctgtgtg
ggggttttccagcatggaaaagtggaaatcattgccaacgaccagggcaacaggaccacc
cccagctacgtggccttcaccgacaccgagaggctgattggagacgcagccaagaaccag
gtggctctgaaccccagcaacacggtgtttgacgccaagaggctgatcggaagaaagttt
gatgatccgctggtgcaggctgacatgaagcactggcccttcaaggtgctttcagacgga
gggaagcccaaaatccaggtggagtacaaaggggaggacaaaaccttctaccctgaggag
gtgtcctccatggtcctggtgaagatgaaggagaccgccgaggcctacctgggccacaag
gtgtccaacgccgtcatcacggtcccggcgtacttcaacgactcccagcgacaggccact
aaagacgccggcgtcatcgctggactcaacgtcctgaggatcatcaacgagcccacagcg
gccgccatcgcctacggtctggacaaaggcaagtctggagaacgaaacgtcctgatcttc
gacctgggcggaggcaccttcgacgtgtccgtcctgaccatcgaggatggcatctttgag
gtgaaggccacggccggagacactcacctgggaggagaggactttgacaaccgcatggtc
aaccactttgtggaggagttcaagaggaagcacaagaaggacgtgagccagaacaagaga
gccttgaggaggctgcgcacagcttgcgagagggccaagaggacgctgtcctccagctcc
caggccagcatcgagatcgactccctgttggagggcaccgacttctacacctccatcacc
agggctcgcttcgaggagctgtgctccgacctgttcaggggaacgttggagccagtggag
aaagccctgagggacgccaagatggacaaggctcagatccatgacgtggtcctggtggga
ggctccacccgaatccccaaaatccagaagctgctgcaggacttcttcaacggccgcgag
ctcaacaggagcatcaacccggacgaggcggtggcttacggcgctgccgtccaggccgcc
gtcctctcaggggacacctcggccaatgtccaggacatgctgctgctggacgtggcgcct
ctgtccctgggcatcgagacggccggaggagtcatggccccgctgatcaaacgcaacacc
accatccccagcaagcagacgcaggtgttcagcacctactctgacaaccagcccggggtc
ctgatccaggtttacgaaggcgagagagccatgaccaaggacaacaacctgctgggcaag
tttgagctgtcgggaatcccacccgccccgcgaggcgtcccgcagatccaggtgaccttc
gacatcgatgccaacggcatcctgaacgtgtcggcggtggacaagagcaccggcagagag
aacaagatcaccatcagcaacgataagggccgactgagcaaagaagagatcgagaggatg
gtgcaggacgccgaaaagtacaaagcagaggacgaggagcagagggacaaaatcgcagcc
aagaactcgctggagtcgctggccttcaacatgaagagcagcctgcaggacgacagcgtg
aagggcagaatgagtgaggaggagcagaagaagctgctggagaagtgtgaggaaaccatc
agctggctggagaacaaccagctggctgacaaagacgagttccaacacaagcagaaggag
ctggagaaagtgtgcaaccccatcatcagcaagttgtatcagggagggaggcctgcaggc
agctgtagagagcaggcaggaggcccccaggggcccacagtggaggaggtggactga

DBGET integrated database retrieval system