KEGG   Amphiprion ocellaris (clown anemonefish): 111572615
Entry
111572615         CDS       T06018                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00100  Steroid biosynthesis
aoce01100  Metabolic pathways
Module
aoce_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111572615 (tm7sf2)
Enzymes [BR:aoce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111572615 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT DUF4083
Other DBs
NCBI-GeneID: 111572615
NCBI-ProteinID: XP_023132124
Ensembl: ENSAOCG00000022806
Position
Unknown
AA seq 425 aa
MRPNSQALKHKVPHDTEREFGGTLGAICIPIFLPLTVLFLICVSRSPEASVLQWPPPLPS
QDQLWDPVAPMLLLAWITLHTLLYFMPLGKVSEGLLLRDGTRLKYPINGFHALCISGVLL
MLLLGLGAPMGYLFELLVPLAVCAIAVSFVFSVYLYIRSFWAPSHALALGGNTGNPLYDF
FIGRELNPRIGSFDLKYFCELRPGLIGWVVINFGMLMKEVELRGSPSLAMILVNSFQLLY
VADALWNEEAVLSTMDIVHDGFGFMLVFGDLAWVPFTYGLQAAFLVVHPQALTSLRAAAI
IALNGAGYYIFRKSNSQKNQFRRDPSHPTVARLETIATATGKRLLVSGWWGFVRHPNYLG
DLLMALAWSLPCGFSHLLPYFYVIYFTVLLIHREDRDERQCRAKYGLAWDTYCRRVPYRI
FPYIY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgagaccaaacagtcaagcactgaaacacaaagtgccacatgacacagagagggagttt
ggaggaaccctgggtgccatatgcattcccatcttccttccgctgacggtgctgttcctg
atctgtgtgagtcggtctcctgaggccagtgtgcttcagtggcctcctcctctcccctcc
caggaccagctgtgggacccagtggcccccatgcttctgctggcatggatcactctgcac
accctcctctatttcatgccattaggaaaggtgtctgaaggattactgctgagggatgga
acacgtctcaagtatcccataaacggttttcatgccttgtgcatcagcggtgtgttgctg
atgttgctgctgggacttggggctcctatggggtatctgtttgagctgctggtgcctctg
gcagtgtgtgcaattgcagtgtcattcgtgttctcggtctacctctacatccgctccttc
tgggctccttcccatgctctcgctttggggggcaacacaggaaatcctctgtatgacttc
ttcattggacgagagctaaaccctcggattggaagctttgacctgaaatatttctgtgag
ctcagaccgggtttgattggctgggtggtcataaactttggcatgctgatgaaggaggtg
gagcttcgaggttcgccctccctcgccatgatcctcgtcaacagtttccagctgctgtac
gtggccgatgctctgtggaacgaggaggccgttctgagcaccatggacattgtgcatgat
ggttttggtttcatgctggtgttcggtgacctggcctgggttcccttcacgtacggcctg
caggcagccttcctggtcgtccacccgcaggccttaacgtccctcagagctgcagctata
atagcactgaatggtgctggatattacattttcagaaaatccaactcacagaagaaccag
ttcagacgagacccttctcatccaactgttgcaagactggagacgattgctacggcaaca
gggaagcggctgctggtgtccggctggtggggtttcgttcgtcatcctaattacctcggt
gacctcctcatggccctggcgtggtccctgccatgtggtttctcacatctgctcccttac
ttctacgtcatttacttcaccgtgttgctgattcaccgagaggaccgtgatgagagacag
tgtagggccaagtatggactggcatgggacacctactgcagacgtgtcccctacaggatc
ttcccttatatttattga

DBGET integrated database retrieval system