KEGG   Amphiprion ocellaris (clown anemonefish): 111573361Help
Entry
111573361         CDS       T06018                                 

Definition
(RefSeq) septin-2
  KO
K16942  septin 2
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aoce04131]
    111573361
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aoce04812]
    111573361
   04147 Exosome [BR:aoce04147]
    111573361
Membrane trafficking [BR:aoce04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    111573361
Cytoskeleton proteins [BR:aoce04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     111573361
Exosome [BR:aoce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111573361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU RsgA_GTPase AIG1 Ras Dynamin_N Roc AAA_22 AAA_16 Gtr1_RagA AAA_7 AAA_29 ABC_tran
Motif
Other DBs
NCBI-GeneID: 111573361
NCBI-ProteinID: XP_023133254
Ensembl: ENSAOCG00000015026
Position
Unknown
AA seq 348 aa AA seqDB search
MSQSGEKGKFPDTAGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTD
LYPERYIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINSQDCFKTIIQY
IDNQFERYLHDESGLNRRHIVDNRVHCCFYFISPFGHGLKPLDVEFMKAIHSKVNIVPVI
AKADTLTLKERDRLKRRILDEIAEHGIKIYQLPDADSDEDEEFKEQTRVLKASIPFAVIG
SNQLIEVKGKKIRGRLYPWGVVEVENPEHNDFLKLRTMLVTHMQDLQEVTQDLHYENFRS
ERLKRAGRAVDEDVVDKDQILLQKEAELRRMQEMIAQMQAKMRMQSDE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtctggagaaaaagggaagttcccagatacagcaggttatgtaggatttgcc
aacctccccaatcaagtgcaccgaaaatcagtgaaaaaagggtttgaatttaccctgatg
gttgtgggggagtctggtttgggaaaatcgacacttataaacagtctgtttctcactgat
ctctaccctgaacgctacatccctggtgccgccgagaagattgagaggacggtgcagatt
gaggcatcgactgtggaaattgaggagagaggagtgaaacttcgtcttactgttgttgac
acccctggatatggcgatgccatcaacagccaggactgcttcaagaccatcatccagtac
attgacaatcagtttgagcgatacctccatgatgagagtgggctgaaccgaagacacata
gtggacaaccgggtgcactgctgcttctacttcatttctccatttggacacggtctaaag
cctctggatgtggagtttatgaaggccatccacagcaaagttaacattgtcccagtcatc
gccaaggctgacacactgacactaaaggagagagatcgcctgaagaggaggatcctggac
gagatcgcagagcatgggatcaaaatttatcagctacctgatgctgactctgacgaggat
gaggagttcaaggaacagaccagagtcctgaaggcgagcattcccttcgctgtgatcggc
tccaaccagctgatcgaggtgaaagggaagaagattcgtggtcgtctttacccctgggga
gtagtagaggtggagaatcctgagcacaatgacttcctcaaactacgcaccatgcttgtg
acccacatgcaagacctccaggaggtaactcaggacctgcattacgagaacttccgctcg
gagagactgaagagagccggcagagctgtggatgaggatgtggtggataaggaccagatc
ctgctacaaaaagaggctgagctgagacgcatgcaggagatgatcgctcagatgcaggca
aagatgagaatgcaatcagacgagtag

DBGET integrated database retrieval system