KEGG   Amphiprion ocellaris (clown anemonefish): 111575853
Entry
111575853         CDS       T06018                                 

Definition
(RefSeq) deoxycytidine kinase-like isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00230  Purine metabolism
aoce00240  Pyrimidine metabolism
aoce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111575853
   00240 Pyrimidine metabolism
    111575853
Enzymes [BR:aoce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111575853
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 CoaE
Other DBs
NCBI-GeneID: 111575853
NCBI-ProteinID: XP_023137000
Ensembl: ENSAOCG00000023754
Position
Unknown
AA seq 319 aa
MMSALYGCVLFNCVSKLRKQTALTQVRRFVQWKMSGGLIRAGNTATPPTIVAMANRKRNL
SFPSSRCLSKSAEEAKARVKRVSIEGNIAVGKSTFAKLLQSACSDWEVMAEPVSKWQNIR
SETSKGTEPQSTVSNLLQMMYQDPQRWSYTFQTYSCMSRLRTQLQPPPACLLNSEGTPVQ
VYERSVYSDRYIFALNMFELGCINTTEWAVYQDWHSLLVEQFGHQVELEGIIYLRAPAKK
CMERLKKRGRAEEKGVKLDYLDKLHVQHERWLVEKSTEIHFEKLKQIPVLELDASVEFKS
DPVVREQFITKVKNFFNAL
NT seq 960 nt   +upstreamnt  +downstreamnt
atgatgtcagcgctgtatggatgtgttttattcaactgtgtttccaaattaagaaagcaa
acagctttgacacaggtcaggagatttgtgcagtggaaaatgtctgggggtttaatacga
gctggaaacacagcaacaccaccgacaatagtagcgatggctaataggaaaaggaatctc
agttttccttcttcgaggtgcctgtcaaagtcagctgaggaggcaaaagctcgagtgaag
agagtttctatcgagggcaacattgctgttggaaagtccacctttgctaaactcctgcag
tcggcttgttcagactgggaagtgatggcagagcctgtcagcaagtggcagaacatcagg
agtgagacctccaaggggacagagccccagtcaacagtcagcaacctgctgcagatgatg
taccaggaccctcagcgctggtcttacacatttcagacatattcctgtatgagccggctg
agaacacagctacaacctcctccagcttgcctgcttaactcagagggaacacctgtccag
gtgtatgagcgctcagtctacagtgacaggtacatctttgctctcaacatgtttgagctg
ggttgtatcaacactacagagtgggcagtctaccaggactggcactcactgctggtggag
cagtttggacaccaagtggagctagagggcatcatttacctcagagccccagcaaaaaaa
tgtatggagcgtctgaagaagcggggaagagcagaggagaagggagtgaaactggactat
ctggataagctgcatgttcagcatgagaggtggctagttgagaaaagcaccgagatccat
tttgagaagttaaaacagatacctgttttagaactcgatgccagtgtggagtttaagagt
gatccagttgtgcgggagcaatttattaccaaggtgaagaactttttcaatgctttatga

DBGET integrated database retrieval system