KEGG   Amphiprion ocellaris (clown anemonefish): 111576056
Entry
111576056         CDS       T06018                                 

Gene name
asic1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aoce04040]
    111576056 (asic1)
Ion channels [BR:aoce04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   111576056 (asic1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 111576056
NCBI-ProteinID: XP_023137322
Ensembl: ENSAOCG00000004608
Position
Unknown
AA seq 560 aa
MPVRIMCTISFSADDEPGRGYGKDSFDDHYKRVKKSYSDGDSQEFLDRCSQVDDYTDEED
NVSEVDDLATFFSGCSLHGANHVFVEDKKFGIRQGLWAVVFTMALSAFLYQVADRVIYYL
QFDYITMLDEKVANNMTFPAVTICNYNFVRKSQMSYSDLIFMGPLLGFEEGMAPGFPLAP
EPDRPPGSRFSLDEFYSRTRHRIEDMLLECNFRGLECGPENFREIFTRYGKCYTFNSGQD
GRPLLVTMKGGTGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLG
FGVAPGFQTFVSCQEQRLTYLPPPWGDCKATPMDSDFFNTYSITACRIDCETRYLVENCN
CRMVHMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCETPCNLTRYGKELSFVKIPSK
ASAKYLAKKFNKTEQYIADNILVLDIYFEALNYETIEQKKAYELAGLLGDIGGQMGLFIG
ASILTVLELFDYLYEVIKYKMCRCMKKKHKGRNNNDRGAVLSLDDVKRHAPCENLRTPST
YPGNMLPHHPGQGNFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgccagtccggatcatgtgcaccatctccttttcggccgatgacgaacccggcagagga
tatggtaaagacagttttgatgaccattacaagcgtgttaaaaagagctatagtgacggg
gactcacaggagttcctggaccggtgcagtcaggtggatgattacactgatgaggaggac
aacgtcagcgaggtggacgacctggccactttcttcagtggttgctcgctgcacggcgcc
aaccacgtgtttgtagaggacaagaagtttggcatccgtcagggtttgtgggctgtggtc
ttcaccatggccctgtctgctttcttgtatcaggtagccgacagggttatttattatctc
cagttcgattacatcaccatgctggatgagaaggtggccaacaacatgacctttcctgcc
gtcaccatatgcaactacaactttgttcgtaaatctcagatgagctacagcgacttgatt
ttcatgggccctctgctgggcttcgaggaaggcatggccccggggttcccactggccccg
gagccggaccgcccgccaggctctcgcttcagcctggatgagttctacagccgtactcga
caccgcatagaggacatgctgctggaatgtaacttcagaggtttagagtgcggtcccgag
aacttcagagagatcttcacacgctacggaaaatgctacacgtttaattcgggtcaagat
ggacgacccctgctggtgacgatgaagggcgggacgggtaacggcctggagctgatgctg
gatatccagcaggatgaatacttgcctgtgtggggagaaaccgacgagacatcgtttgaa
gcagggatcaaagttcagatccacacccaggacgagccgccgttcatagaccagctgggc
ttcggagtggcgccggggtttcagacctttgtctcctgtcaggaacagcggctgacgtac
ctgcctccaccgtggggggactgcaaagccacaccgatggactcagacttcttcaacact
tacagcatcacagcctgccggatcgactgtgagacgcgatacctggtggagaactgcaac
tgcaggatggtccacatgcctggagatgccccatactgcaccccagagcagtacaaggag
tgtgcagatcctgccctggacttccttgtcgagagagacaatgactactgcgtgtgcgag
acgccatgcaacctgacacgctacggtaaagagctgtcctttgtcaagatacccagcaaa
gcatcggcaaagtacctcgccaagaaattcaacaagacagagcagtacatagctgataac
attctggttctggatatctactttgaagcgctgaactacgaaaccattgaacaaaagaaa
gcttacgaattggcaggccttctgggtgatatcggaggtcagatgggtctcttcattgga
gccagcatcctcaccgttcttgaactctttgactatctatatgaggtgatcaaatacaag
atgtgccgatgcatgaagaagaaacacaaaggccgcaacaacaatgaccggggagctgtg
ctgagcctggatgatgtgaaacgccatgctccttgcgagaacctgcgtacaccatcgacg
tatcctggcaacatgctacctcatcatccgggccagggtaactttgaagacttcacttgc
tga

DBGET integrated database retrieval system