KEGG   Amphiprion ocellaris (clown anemonefish): 111576058
Entry
111576058         CDS       T06018                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    111576058 (rdh5)
Enzymes [BR:aoce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     111576058 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 NAD_binding_10
Other DBs
NCBI-GeneID: 111576058
NCBI-ProteinID: XP_023137325
Ensembl: ENSAOCG00000000179
Position
Unknown
AA seq 347 aa
MFFQQAPSSPSPEGNMATQFVYDLLGENAWLYITATFVVLWFVIWLYRDSLEIESITDKY
VFVTGCDSGFGNLLCKKLDRKGFRVLAGCLTEKGADDLKRVAGPQLKTVLLDVTSQDSIQ
KAMEWTKKEVGENGLWGIVNNAGRSLPMGPSEWMKVEDFHSTLKVNMNGVIGMTMTFLPL
IKKARGRIVNVASVLGRVAANGGGYCISKFAVESFSDCLRRDINYFGINVCIIEPGFFKT
AVTSLEPIERELHRLWNQLSPEVKASYGDKYLDKYIAVQRLIMNAVCDSDLSKVTDCMEH
AVTAAYPRTRYSAGWDAKLLWIPLSYMPSCVIDIGLKLVLPRPSKSV
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgttttttcagcaagctccaagctctccttctcctgaaggcaacatggctacacagttt
gtctatgacctcttaggggaaaatgcttggctctacatcactgctactttcgtggtgttg
tggtttgtcatttggttatacagagacagcctggagattgaaagcatcactgacaagtat
gtctttgtgaccggctgcgactcggggtttggaaacctgctgtgtaagaagcttgaccgc
aaaggtttccgtgtgctggctggttgtctcacagagaagggagctgatgatctcaaaaga
gtagcagggcctcaactcaagacagtcctgctggatgttaccagtcaggacagtatccag
aaagccatggagtggaccaagaaggaggtcggcgaaaacggactttggggtatcgtgaac
aatgctggccgctcgttaccaatgggtccttcagagtggatgaaagtggaggatttccac
agcacgctgaaagtaaacatgaacggagtgatcggcatgacaatgaccttcctgcctctc
atcaaaaaggcccgtggccgtattgtaaacgtagcatcagtgctgggtagggtggctgca
aacggtggtggatattgcatctccaagtttgcagtggagtctttctctgactgcctcagg
agagacatcaactactttgggatcaacgtgtgcatcattgagccgggctttttcaagact
gcagtgacgagcctggagcccatcgagagggagctgcatcgactgtggaaccagctcagc
cctgaggtgaaagccagctatggagacaagtacctcgataagtatatcgccgtccagcgt
ctgatcatgaatgctgtgtgtgactctgacctcagcaaggtgaccgactgcatggagcat
gccgtgactgctgcctacccacgcaccagatacagcgccggctgggatgccaagcttctc
tggatccccctgtcttacatgccttcctgtgtcattgacattggactaaagctggtgctg
ccacgtccttcaaagagcgtgtaa

DBGET integrated database retrieval system