KEGG   Amphiprion ocellaris (clown anemonefish): 111577528Help
Entry
111577528         CDS       T06018                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04060  Cytokine-cytokine receptor interaction
aoce04068  FoxO signaling pathway
aoce04210  Apoptosis
aoce04217  Necroptosis
aoce05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111577528
   04068 FoxO signaling pathway
    111577528
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111577528
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111577528
   04217 Necroptosis
    111577528
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111577528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aoce04147]
    111577528
   04052 Cytokines and growth factors [BR:aoce04052]
    111577528
   04090 CD molecules [BR:aoce04090]
    111577528
Exosome [BR:aoce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111577528
Cytokines and growth factors [BR:aoce04052]
 Cytokines
  Tumor necrosis fators
   111577528
CD molecules [BR:aoce04090]
 Proteins
  111577528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 111577528
NCBI-ProteinID: XP_023139628
Position
Unknown
AA seq 265 aa AA seqDB search
MSYDQSYPFPQVFLVDDSGRPQHSAQPPGLIPCWSFPPAQQRLRSRGKSEGCMGIRPGVA
LIVLLLFLLVFAALGFEAYQIMNIQKELRQVEPETEVAAPQKQMGFYEPQISGEDKKDRP
AAHVIGRIEIRHQDFKTLRWEPKTGQAFISGGVAYRIEDGALQVNESGLYHIYSRVELFF
GKCSSTSSFDHSVFVRRSGHSSPLRLMEAHRMGFCSQQPSRTFTTDSFLSSAQQLKKYDR
VFVNISHPNLLSHSHYGNFFGLYQI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgaccagagctaccccttcccccaggtgttccttgtggatgatagtggacgt
cctcagcactctgcccagcctccgggtctcatcccctgctggtccttccctcccgcccag
cagaggctgaggagccgtgggaagagcgagggctgcatgggaattcgccccggtgtggcc
ttgatcgtgctgctgctgttcctgctggtgtttgcagccctcggcttcgaagcctaccag
attatgaacatacagaaagaactgagacaggttgagcctgagacggaggttgctgcgcct
cagaagcaaatgggtttctatgaaccccagatcagtggagaagataagaaagacagacct
gcagcacacgtgataggacgcattgaaattagacatcaagacttcaagactctgcgatgg
gagccaaagacaggtcaggcgttcatctctggaggagttgcttaccggattgaagacggg
gctctgcaggtcaacgagtcgggactctaccacatttactcacgagtggagctgttcttt
gggaaatgctcttccacttcctcgtttgatcactctgtgtttgtgaggagatcaggacat
tcctcccctctgagactgatggaggcccacaggatgggtttctgctctcagcaaccctcc
cgtaccttcaccactgacagtttccttagctctgctcagcagctgaagaaatacgacagg
gtttttgtgaatatttcacacccgaatcttcttagtcactcacattatggcaacttcttt
ggtctctaccagatctga

DBGET integrated database retrieval system