KEGG   Amphiprion ocellaris (clown anemonefish): 111577857Help
Entry
111577857         CDS       T06018                                 

Gene name
erp44
Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aoce04131]
    111577857 (erp44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aoce04147]
    111577857 (erp44)
Membrane trafficking [BR:aoce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    111577857 (erp44)
Exosome [BR:aoce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111577857 (erp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin HyaE OST3_OST6 Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 111577857
NCBI-ProteinID: XP_023140101
Ensembl: ENSAOCG00000019170
Position
Unknown
AA seq 410 aa AA seqDB search
MKLLAAPPSLDTRFVTVILLMMGLSTPGQAEITSLDTNNIDDVLNNAGVALVNFYADWCR
FSQMLHPIFEEASNIVREEFPDTKQVVFARVDCDQHSDIAQRYRITKYPTLKLFRNGMMM
KREYRGQRSVVAIADFIRQQKVDPVKEIHSMEEVNTVDRSKRNIIGYFEKKDSDNYHTYE
KVANILRDDCTFLAAFGAVSESERFSGDNVIYKPLGENVPDMVYLGSLTNFDLTYAWAQD
KCVPLVREITFENGEELTEEGIPFLILFHVKEDTDSLEKFQQEVARQLISEKGSINFLHA
DCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFPDFKDLDTPGKLRQFVVDLHSGKLHRE
FHHGPDPTDSTPGQEEMGGEVASSPPESSFKKLGPSETRYTILTRDRDEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttagcggcacctccgtctctcgacacccgcttcgtgacggttattctgctg
atgatgggcctctctactcctggacaagcagaaatcaccagtctggacacgaacaacatt
gatgacgtcctaaataatgctggggtggcattagtgaatttttatgcagactggtgtaga
ttcagtcagatgctccatccgatttttgaggaggcatctaacatagtgagggaggagttt
cctgataccaagcaggtggtgttcgctcgcgtcgactgtgaccaacattcggacatagca
cagcgctaccgcatcaccaagtacccgacgctgaagttgttccgcaatggcatgatgatg
aagagggagtacaggggtcagaggtcggtggtggccatcgctgacttcatccgccagcag
aaggtcgacccagtaaaagaaatacactcaatggaggaggttaatactgtggataggagc
aagaggaacatcataggctactttgaaaaaaaggactccgataactaccacacatatgaa
aaagttgccaacatccttcgagatgactgcacattcttggctgcctttggcgccgtatct
gagtccgagcgcttcagcggagacaacgtgatctacaaacctctgggcgagaacgttccc
gacatggtctacctcggatccctcaccaactttgacctgacgtacgcttgggcccaggac
aagtgtgtgcctctggtcagggagatcacctttgaaaatggagaggagctgactgaagaa
ggaatccctttcctcattttgttccacgttaaagaagacacagacagcttagagaagttc
caacaggaagtagctcgccagctcatcagcgagaaagggtctataaacttccttcatgcg
gactgcgataagttccgccatcctctcctccatatccagaaaactccagctgactgtccc
gtcattgccatagactcattcagacacatgtatgtcttccccgacttcaaagacctcgat
acccctggtaaactgagacagtttgttgtggaccttcactccggtaagcttcaccgagag
ttccaccacggccccgaccccacggacagcacgcctggacaggaggagatgggcggagag
gtggccagcagtccaccggagagctcgttcaaaaagctcgggcccagcgagacccgctac
accattctcacccgggaccgcgacgagctgtga

DBGET integrated database retrieval system