KEGG   Amphiprion ocellaris (clown anemonefish): 111580211
Entry
111580211         CDS       T06018                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aoce03036]
    111580211 (ankrd53)
Chromosome and associated proteins [BR:aoce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    111580211 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank
Other DBs
NCBI-GeneID: 111580211
NCBI-ProteinID: XP_023143615
Ensembl: ENSAOCG00000002960
Position
Unknown
AA seq 383 aa
MTTILKHRKKSRRAPPGSRKLPGICTGSPEKLQVNGEDVSALHVACLYGQLAAVQLLVDS
KLEWINSRGSRGCRPLHMVLTSKSSTTSACLRYLLEHKADVNATDDSGQTPLHLAASEGL
LDCVEMLVEAGADVLLKDSIGLMPLDFARIWCHRTVARYLKSCMWQVEKKKEMEERKLAQ
VLYRDLVDMAKQNKLNEKTREGKMAEWENKKGLPPLKDFSSRTEVTKYHTQCLLPNKSSS
NPKRSTGLCKPGHPQQDRKTTTKQPAASSPGPWTIFTGLQPEKPPTEPDLQDSVTLRRDK
NSRLLQYTTKWNDKPQPTPKLPLDVLERVLFPRAFPSRIASPQQFKPQNIAEVPHRRRPQ
GQSTSPWTKVAMHLAEVLEPGHY
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgacgacaattttaaaacacaggaaaaaatcccgtcgagctccgccaggcagccggaag
ttgccaggtatttgtacaggaagcccagagaagctgcaggtgaacggagaggatgtgtca
gcacttcatgtggcctgcctttatggccagctggctgctgttcagctcctggtggactcc
aagttggagtggatcaacagccgtggctccagaggttgtcggccccttcacatggtcctg
acctccaagagctccaccacctccgcctgcctcagatacctgctggagcacaaggctgat
gtcaacgctaccgatgactcaggccagaccccactgcacctggccgcctctgagggcctc
ctcgactgcgtggagatgctcgtggaggccggagcagatgtgttgctcaaggacagcata
ggactcatgcctctggactttgcccgcatctggtgccacaggacggtagcaaggtatctg
aaaagctgcatgtggcaggtagagaagaagaaggaaatggaggagagaaagcttgctcaa
gtcttgtacagggatcttgtggatatggctaagcagaataaacttaacgaaaagacacgt
gaggggaagatggcagagtgggaaaacaagaaaggtttgccccccctaaaggatttctcc
tccaggactgaggtgaccaagtatcatactcagtgcctcttaccaaacaagagcagctct
aatccaaaacgctccacgggtctgtgtaagcctggacaccctcaacaggacaggaagacc
accactaagcaacctgcagcttcatcccccgggccctggaccatcttcacgggcctccag
ccagagaaaccccccacagagcccgaccttcaggacagtgtcacattaaggagggacaaa
aacagcaggctacttcagtataccaccaagtggaacgacaagcctcagccgactcctaag
ctgcctctggatgtccttgagagggtgttgttccccagagccttcccctccaggatcgcc
tcccctcagcaatttaagccacagaacatcgcagaggtcccgcatcgaaggagacctcag
gggcaaagcacctctccatggacgaaggtggccatgcatctggctgaggtgctggagcct
ggacactactga

DBGET integrated database retrieval system