KEGG   Amphiprion ocellaris (clown anemonefish): 111581460Help
Entry
111581460         CDS       T06018                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04260  Cardiac muscle contraction
aoce04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111581460
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111581460
   04261 Adrenergic signaling in cardiomyocytes
    111581460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aoce04040]
    111581460
Ion channels [BR:aoce04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111581460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 111581460
NCBI-ProteinID: XP_023145407
Ensembl: ENSAOCG00000018871
Position
Unknown
AA seq 145 aa AA seqDB search
MRLCNRGVMMLLTTAGAFCAFSLMTIAVGTDYWLYSRGMCRSKSQNDNETVRKNEEVLTH
SGLWRTCCTEGTFRGVCKDIDHFPDDADYEQDAAEYLLRAVRASSLFPILSVGLLFLGGV
CVAASEFYKSRYNVILSAGILFVSA
NT seq 436 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgtgtaaccggggcgtgatgatgctgctgaccacggcgggggctttctgcgcc
ttcagcctcatgaccatcgccgtgggcaccgactactggctgtactcccgcggaatgtgt
cgctccaagagccagaacgacaacgagactgtccgcaagaacgaggaggttctgacccac
tcgggtctgtggaggacctgctgcacggagggaacttttcggggggtttgcaaagacatc
gatcactttcctgacgatgcagactacgagcaggatgctgcagagtatttactacgagca
gtacgagcctccagcctcttccccatcctcagcgtgggattgttgttccttgggggagtc
tgtgtagctgccagtgagttctacaagtcacgctacaacgtcattctcagcgcgggaatt
ctgtttgtttctgcag

DBGET integrated database retrieval system