KEGG   Amphiprion ocellaris (clown anemonefish): 111582108
Entry
111582108         CDS       T06018                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04080  Neuroactive ligand-receptor interaction
aoce04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111582108 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111582108 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 111582108
NCBI-ProteinID: XP_023146370
Ensembl: ENSAOCG00000020672
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASTEHGRELEEAATVRKMVQQNPARGGQTHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccacagagcatggcagagagctggaagaggcggctacggtg
agaaaaatggtccagcaaaacccagcaaggggcggtcagacccacagaccagctggctgg
aagagaagacgccctcggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system