KEGG   Amphiprion ocellaris (clown anemonefish): 111585856Help
Entry
111585856         CDS       T06018                                 

Definition
(RefSeq) glutamate receptor 1-like
  KO
K05197  glutamate receptor 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111585856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aoce04040]
    111585856
Ion channels [BR:aoce04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   111585856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 111585856
NCBI-ProteinID: XP_023151243
Ensembl: ENSAOCG00000004679
Position
Unknown
AA seq 953 aa AA seqDB search
MRLQSFVPVPSVRSVRSVRLPPPLLLLLFGLCSGTSFPTNINIGGLFPTGSHEYEVFRFA
LAQNQDVPKLVPQVDMVDTSSSFAMTYAFCSQFSKGVYAIMGLYDRRTVNMLMSFCGSLH
VCFVTPSFPVLTNNQFVLQLRPQLQEPLMALLEHFYWNHFVYMYSSNSGLSVLQRILDTA
AERSWQVTSVNLDTLTEVSFIKLLADLDYKKEFQIIIDCELERLNSIINLIAAQKRNLKN
YHYILNNLGFLDLNVTEFQNLGPNVTGFQLMNRSDPLVQKINQEWMEFDSRDLKLVRRRL
KYTGALTYDGVIVMATAFNNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRL
DGLTGRIQFDERGHRTNYTLTVMELSPAGPRKMGYWNEKQGYVNTAVYKPVLEEFHGLQN
RTYVVTTILEAPYMMLKTNHEKLEGNDKYEGYCAELASEIAKHVGFSYRLQLVGDGKYGA
RDSETKMWNGMVGELVYGSADVAVAPLTITLVREQVIDFTKPFMSLGISIMIKKPTKSKP
GVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWQGDDSDDEDETLPSSSSRRPP
PTSSSELTQSPGNQNQQKEKEAPEHTNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVG
GVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFKRS
KIAVFEKMWSYMRSADPTVFVKNTNEGVVRVRKSKGKYAYLLESSMNEYIEQRKPCDTMK
VGGNLDSKGYGVATPKGSPLRNPVNLAVLKLNEQGLLDKLKNRWWYDKGECGTGGGDSKD
KTSALSLSNVAGVFYILIGGLGLAMMVALVEFCYKSRIESRRMKELIDAAMMSTTLGGMA
VAGGGVAAGGLGGASGLGGENGRVVAHDFPKAGAQGLPCMSKAAGLGLSSTGM
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcagagcttcgtgccggtcccgtcggtccggtccgtccggtccgtccgcctc
ccgccgccgctgctgctgctgctgttcgggctctgcagcggaacaagtttcccaacaaac
atcaacatcggaggtcttttccccaccggttctcatgagtatgaggtgtttcggtttgct
ctggcccagaaccaggacgttcccaaactggttccccaggtggacatggtggacaccagc
agcagcttcgccatgacctacgccttctgctcccagttctccaaaggcgtgtacgccatc
atgggtctgtacgaccggaggaccgtcaacatgctgatgtctttctgcggctcgctgcac
gtctgcttcgtcactccgtccttccccgtcctcaccaacaaccagttcgtcctgcagctc
cgtcctcagctgcaggagcctctgatggcgctgctggagcacttctactggaaccacttc
gtctacatgtacagctccaattcaggtctgtcggttcttcagaggatcctggacacggcg
gctgagcggagctggcaggtgacctcggtgaacctggacactctgacagaggtctccttc
atcaagctgctggccgacctagactacaagaaggagttccagatcatcatcgactgcgag
ctggagcgcctcaactccatcatcaacctgatcgctgctcagaagaggaacctgaagaac
taccactacatcctcaacaacttgggtttcctggacctgaacgtcactgagttccagaat
ctgggtccaaacgtaaccggcttccagctgatgaaccgaagtgacccgttagttcagaaa
atcaaccaggagtggatggagttcgatagtagagacctgaagctggtcaggaggaggctg
aagtacaccggagctctgacctatgacggggtcatcgtcatggcgacagccttcaacaac
ctgcggcggcaacggatcgacatctctcgccgtggcaacgctggagagtgtctggccaat
ccgccggctccgtgggggcagggcatcgacatccagagagccctgcagcaggtccgtctg
gatggtctgacaggtcgaatccagttcgatgagcgaggacatcggaccaactacaccctg
acagtgatggagctgagcccagctggacccaggaagatgggctactggaacgagaagcaa
ggctacgtcaacacggccgtctacaagccggttctggaggagttccacggtctgcagaac
agaacctatgtggtcaccaccatcctggaggcgccgtacatgatgctgaagacgaaccat
gagaagctggaggggaatgataaatacgaagggtactgtgcagaactcgcctcggaaatc
gccaaacacgtgggcttcagctaccgactgcagctggtgggcgacgggaagtatggcgcc
agagactctgagaccaagatgtggaacggcatggtgggagaactggtgtacgggagtgct
gacgtggccgtggctccgctcaccatcacgctggtccgagagcaggtcatcgacttcacc
aaacccttcatgtctctggggatctccatcatgatcaagaagcccaccaagtccaaaccg
ggggtcttttccttcctggacccactggcctacgagatctggatgtgcatcgtgttcgcc
tacattggtgtcagcgtggttctgttcctggtgagtcgcttcagtccttatgagtggcag
ggagacgactctgatgatgaagatgaaactctgccctcctcttcctcacgaagacctcca
ccgacttcatcctctgaactcacccagtctccagggaaccagaaccagcagaaggagaag
gaggctccagaacacaccaatgactttgggatcttcaactctctgtggttctctctggga
gccttcatgcagcagggctgtgacatctcgcccaggtctctgtcgggtcggattgtggga
ggagtttggtggttcttcaccctcatcatcatctcctcgtatacggccaacctggcagcc
ttcctcaccgtggagaggatggtctcccccatagagagtgcagaagacctggccaagcag
acggagatcgcctacgggaccctggacggaggttccaccaaagagttcttcaagcgctcc
aagatcgccgtgttcgagaagatgtggtcgtacatgcgcagcgccgaccccacggtgttc
gtgaagaacaccaacgagggcgtggtgcgggtccgcaagtcgaaggggaagtacgcctac
ctgctggagtcgtccatgaacgagtacatcgagcagaggaagccctgcgacaccatgaag
gtgggaggaaacctggactccaagggctacggggtggccacgcccaaaggatctccactc
agaaaccccgttaacttggcagtgttaaaactgaacgagcagggcctgttggacaaattg
aaaaacagatggtggtatgacaagggcgagtgcggcaccgggggaggggactccaaggac
aagacgagcgcgctcagtctgagcaacgtggcaggagtgttctacatcctgattggaggg
ctggggctggccatgatggtggctctggtggagttctgctacaagtccaggatcgagtcg
aggaggatgaaggagctcatcgacgctgccatgatgagcaccacgctgggcgggatggcg
gtcgctggcggaggcgtggcggccggcggtctgggaggagcgtcgggactcggcggtgaa
aacggccgagtggtggctcacgacttccctaaagccggagctcagggtttaccctgcatg
agcaaggctgccgggctgggactgtcctccaccggcatgtga

DBGET integrated database retrieval system