KEGG   Amphiprion ocellaris (clown anemonefish): 111586157Help
Entry
111586157         CDS       T06018                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma-like isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00564  Glycerophospholipid metabolism
aoce00565  Ether lipid metabolism
aoce00590  Arachidonic acid metabolism
aoce00591  Linoleic acid metabolism
aoce00592  alpha-Linolenic acid metabolism
aoce01100  Metabolic pathways
aoce04010  MAPK signaling pathway
aoce04217  Necroptosis
aoce04270  Vascular smooth muscle contraction
aoce04370  VEGF signaling pathway
aoce04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111586157
   00565 Ether lipid metabolism
    111586157
   00590 Arachidonic acid metabolism
    111586157
   00591 Linoleic acid metabolism
    111586157
   00592 alpha-Linolenic acid metabolism
    111586157
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111586157
   04370 VEGF signaling pathway
    111586157
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111586157
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111586157
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111586157
Enzymes [BR:aoce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111586157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B DDE_Tnp_IS66
Motif
Other DBs
NCBI-GeneID: 111586157
NCBI-ProteinID: XP_023151615
Ensembl: ENSAOCG00000014522
Position
Unknown
AA seq 591 aa AA seqDB search
MKAGNIGFLVSLWLVISAGLAKEDDIMERNTTASEKAVRQSQSLCDGEREFVQKRKQIVL
ETLNSLEINCTENSVPHIALLGSGGGQRAAVAMVGTLYQLEKDNLLDTLLYLAGVSGSTW
SMASVYSDPQWSTNMDGAISKLLSDRLELEEALAWLNEREKDEYFSLTDIWAVLTSVAIM
KQDLRRLSDEADRNATNPYPIYSAIEKHCFSDGSTEGKWFEISPHEAGFTELGLFVETSL
LGSNFQSGELLEKKPEMDMVKLQGVLGSAMADEKTATDAIPPWLNVDEDSSFQKYWRAYK
ILQKLAGLIGHISKEPADVPDLNMMYKMITDMVNYNHSARFHSNTSEERQEILQELSLEL
LAAVNTWCEDQQDGPFKRQVSAIIKQVIPLIHKWEWGTSRNFLYQFQDPSIPPCLQSNET
IHLIDAGLLINVPYPSFLGDKRDIDLIIAPEYSAGNMFETLTAARNYSAELKKPFPEIDD
AILRDRDWPKDCYVLEGGETAPTIIYMPLFNRRNCKDAEEVKAKRDEYATFQLPYTQEKI
DFVLETAKANMKNNKETLLREIKKAVLRRQNKEYGNPTWQQKLHSCFTGLL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaggaaatataggcttcctggtttcactttggcttgttatttcagcaggtctg
gcaaaagaagatgacatcatggagagaaatacaactgcttctgagaaagccgtccgtcag
tcccagtcgctgtgtgacggcgagcgggagtttgttcagaagaggaaacaaatagttctg
gagaccctaaacagtttggaaatcaactgtactgaaaactcggttccccacatcgccctg
ctgggatcaggtggaggtcagagggccgctgtggctatggtcggtaccctctatcagctg
gagaaggacaatctgctggacaccctgctgtacctggcgggagtttctggctcaacatgg
tccatggcctcagtgtacagtgacccacagtggagcaccaacatggacggagctatttcc
aagctgttgagtgataggctggagctggaggaggccctggcctggttgaacgagagggag
aaagatgaatacttctctctcactgatatctgggcggtcttaacgtctgttgccatcatg
aagcaggacctgaggcgtttgtcagatgaggccgacaggaatgccaccaacccttacccc
atctattctgccatagagaagcactgcttctcagatgggtccacagaagggaaatggttc
gagataagccctcatgaagccggattcacagagttgggtctctttgtcgaaacatctctc
ctgggcagcaattttcagagcggagagctgctggagaagaagccagagatggacatggtc
aaactgcaaggtgtgttaggatctgcgatggctgatgagaagactgccacagatgccatc
cctccctggctgaatgtggatgaggacagttcttttcagaagtactggcgtgcctacaag
atccttcaaaaactggcaggcctgatcggacacatctctaaagaacctgctgatgtacct
gacctgaacatgatgtataaaatgataacagacatggtgaattataatcattctgcaagg
tttcactcaaacacttcagaggaaaggcaggaaattttgcaggagctgagcctggagctg
ctggcagcagtaaacacctggtgtgaagatcagcaggatggacctttcaaaagacaagtt
tctgccattataaaacaagtcattcctctgattcataaatgggagtggggaacatccaga
aacttcctctatcaattccaagatccttctattccaccttgcctccagagtaatgagact
atccatctgatagatgccgggctgctgatcaatgtgccctacccttcatttctgggagac
aagagagacatcgacctcatcattgcaccagagtacagcgctggaaacatgtttgagact
ctgactgctgcaagaaattattcagccgagttgaagaagcctttcccagagatagacgat
gcaatcctgagggacagagactggccgaaggactgctatgtgttggagggaggagaaacg
gcgcccacgatcatctacatgccgctgttcaacagacggaactgcaaagatgccgaagag
gtcaaagcgaagagggacgagtacgccaccttccagctgccctacacccaggagaagatt
gactttgtgctggagacggcaaaagctaacatgaaaaacaacaaggagacgctgctgagg
gagataaagaaggctgttctccgccgacagaacaaagaatacgggaatcctacatggcag
cagaagcttcattcttgctttacaggtttgctgtga

DBGET integrated database retrieval system