KEGG   Amphiprion ocellaris (clown anemonefish): 111586394
Entry
111586394         CDS       T06018                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aoce01002]
    111586394 (adamts13)
Enzymes [BR:aoce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     111586394 (adamts13)
Peptidases and inhibitors [BR:aoce01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   111586394 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_spondin Reprolysin_5 TSP1_CCN Reprolysin_2 ADAM_spacer1 CUB Peptidase_M10
Other DBs
NCBI-GeneID: 111586394
NCBI-ProteinID: XP_023151896
Ensembl: ENSAOCG00000020682
Position
Unknown
AA seq 1388 aa
MLFMTLFCLVLLRPGFSALMSSPLDELFHHSASQRHIVSYRGSSPDTSVSGRLRRSALVP
DITHLELLVVVGPDVQQVHKQDTEKYILTNLNIASELLRDMTLGANMRVHLVRMIILSEP
EPEIQMSTNITSSLRSVCDWGRRINPTNDTDPLHADLLLYITRYDLVLPNGNKQVRGVAQ
LGGACSSEWSCVITEDTGFDLGITIAHEIGHSFGINHDGVGNTCSRSGFMMASDGGYNSV
DLTWSPCSRQQLLTFFSEGKAECVKDLPAMGGSLQDWKPGLYYGVDDQCRIAFGKTARAC
SFTNPDLPACRVLSCHINPDDDSSCKRLLVPLLDGTECAPNQWCLKGRCVSPHDLSSPVV
VHGSWSSWSEFSSCSRTCGGGVTLRTRQCNNPRPAFGGNACGGPDIEAELCHQQPCECTQ
LDFMAEQCSKTNLQPLYLQPHTASFYTWIPALGFARGDEQCRYMCQSDGESFIVSRGSQF
VDGTRCESDTPTPFGTTAACLRGKCKLFGCDGVLHSGKVRDVCGVCGGDGSSCSLTSDSY
TGGQAKEYTTFLSLPVNATQVHVVNRAPLFTHMAVMVGDQYIVSGMGSMALNVTHPSLLD
ENRLEYRLHLTPDLLPAMEELLLPGPLQQEMNVQIYRKYGKDYGEKTNPNISYQFYVPSR
RSDLTDITPKGKWTIFTTPCSVSCGSGVQKQMYACVDEATNNHLEENNCETSPPTTPPHT
TCQLSPCPPRWDAGKFGPCSASCGGGERVRPVKCVQKHGSNVVTVPDSECPPDTTPHTAE
KCNLQHCPARWHVSEPGDCSAVCGPGEAKRVVSCVRPENDQDVEVDQSFCSKQIKPLDSV
PCVVDVCPIGWDSKGEEQPILKSGLLPRSRQAPVYVWSPVISHCSKTCGNGTLQVWFSCV
DHQTRQGAPDFHCDASTKPHPQSEICNTSPCPAMWRSKQGVCSVTCGGGVANRVLYCAGE
AEGEEVVVEDSECSDFPKPSAVVSCNTHSCPARWKVVRSLPCSASCDLGVAQRIVSCVQF
VHGKESVVSEELCHAAMKPATTVPCLVQVCTFRWEVKPWSQCSVPCGYGIQSRAVSCMGP
SKPDPLSPLFCMHMPKPITIQGCNMGVCSDVLSKSDVASDNTTAINTVMRVNLTERPLLS
PTVTNKDTTQSPTEAINIPQTTTATPTPKSSACGQLLLEESGTVDLKHVTSRCTVSIGRP
LDEVIHIRVLSSSLDCTKKEYVAFFDRLAFLRKCVQVAGSELISRTNVLLVRQHLLPAGN
GIVFTYSSQKNMKRSHHRDCDIQLFSPSGVFENPIMSSTNHTCRVLINAPPSVKIRIQAQ
HIGLVFNATNSQSTYIMIRDMDVLKTNVFKGQQLFLWHSSGNMAEIEFHGDYLHSKGSFR
AEYSFLRR
NT seq 4167 nt   +upstreamnt  +downstreamnt
atgctttttatgactctgttctgtctggttttgctgcggcctggcttcagcgccctaatg
agttctccattggacgagctttttcatcactccgccagtcaaagacacatagtttcctat
cgtggttcttctcctgatacctcagttagtgggcggctgcgtcggtcagctctggtgcct
gatatcacacatctggaactcctggtggtagtaggccctgatgtgcagcaggtccacaag
caggatacagaaaaatacatcctcactaacctcaacattgcctcagagctgttgagagac
atgaccctgggcgccaacatgagggtgcacctggtccgcatgatcatcctgtcggagcca
gagccagagatccaaatgtctaccaacatcacctcttctctcagaagtgtgtgtgactgg
ggcagaagaatcaaccccaccaatgacacagatccgctacatgctgatcttctgctgtac
attacaaggtatgacctggtgctgcctaatgggaacaagcaggtcagaggtgtagcccag
ctgggtggagcctgctccagtgaatggagctgtgtgatcaccgaggacacaggcttcgac
ctggggatcaccatcgctcatgaaattggccacagttttggaatcaaccacgacggtgtc
ggaaacacctgcagcaggagcggcttcatgatggcctctgacggaggctacaacagtgtg
gatctgacctggtccccctgcagcaggcagcaacttctcacattcttcagtgaagggaaa
gctgagtgtgtaaaagatctgcctgcaatgggaggctccctacaggactggaagcctgga
ctgtattatggtgttgatgaccagtgtcgtatagcttttggtaaaactgccagagcatgc
tccttcaccaatccagacctgccagcttgtcgtgttctgtcctgtcacattaatcctgat
gatgacagctcctgcaaacgccttcttgttcctcttctggatgggacagagtgtgctcct
aatcagtggtgtctcaagggtcgttgtgtgtctccacatgacctcagctctcctgttgtg
gtccacggttcctggtccagctggtctgagttctcttcctgttcacggacgtgtggtgga
ggagttacactccgcacacggcaatgcaacaacccaagacctgcatttggagggaatgcc
tgtggaggtccagatattgaggctgaactttgtcaccagcagccttgtgagtgcacccag
ctggatttcatggcagagcagtgctcgaaaacaaacctccaacccctctacctgcagcca
cacaccgcctccttctacacctggatcccagctctaggctttgcacgaggggatgagcag
tgcagatatatgtgccagtcagatggagaaagcttcatagtgagccgtggctctcagttt
gtggatgggactcgctgtgagtcagacacaccaacaccttttggcaccacagctgcttgt
ctcagaggcaaatgcaagctgtttggctgtgacggtgtgctgcactctgggaaagtgagg
gatgtgtgtggagtgtgtggtggggatggatcctcctgcagtttgacatctgactcctac
actggtggtcaggctaaagagtacactacctttctctctctgccagtaaatgcaacacag
gttcatgttgtcaacagagcacctctcttcactcatatggctgtaatggttggagatcag
tatattgtgtctggaatgggcagcatggcgctgaatgtgactcacccctccctgctggat
gagaaccgcttagagtaccgcctccacctcacacctgaccttttgcctgcgatggaggag
ctgcttctgcccggtccactgcagcaggagatgaatgtacagatttatcgcaaatatgga
aaagactatggagagaaaacaaatccaaacattagctaccagttctatgtccctagcaga
agaagcgacttgacagacatcacacctaaaggcaaatggaccatttttacaacaccctgc
tcagtgtcttgtggatcaggtgtacagaagcaaatgtatgcctgtgtagatgaagctacc
aacaaccatttggaggaaaacaactgtgaaacatctcctccaaccacacctccccacaca
acctgtcagctctcaccctgtccccccagatgggatgcagggaagtttgggccttgtagt
gcctcctgtggtgggggagagagagtgcgtcctgtaaaatgtgttcagaaacatggatcc
aatgtggtaacggttccagattctgaatgcccacctgataccactccacacacagctgaa
aaatgtaacctgcaacactgccctgccagatggcatgtgtctgagccaggggattgttca
gcggtgtgtgggccaggggaagccaaacgagtcgtgtcatgtgtccggccagaaaatgat
caagatgttgaagtggatcaaagcttctgttcaaagcagatcaaaccacttgattctgtg
ccgtgcgtggtggatgtctgtcccattgggtgggactctaaaggagaggaacagcccatt
ctaaagtctggtttgttaccgcgctctagacaggctccggtgtatgtgtggagccctgtt
attagccactgttcaaagacctgtggcaatggaaccctgcaggtgtggttttcatgcgtg
gaccaccagaccagacagggagcgcccgacttccactgtgatgcttctactaaacctcat
cctcagtctgagatatgcaacacttctccctgccctgctatgtggcgctctaagcaagga
gtctgcagtgtaacgtgtggaggaggggtggccaacagggtgctgtactgtgcaggagaa
gcagaaggggaggaggtggttgtggaggattcagagtgcagtgactttcccaaaccttca
gcagtggtttcatgtaacactcacagctgcccagcaaggtggaaggtagtcaggtcgttg
ccctgctctgcgtcctgtgacctgggtgtagctcagaggattgtgtcttgcgtccagttt
gtccatggcaaggagagtgtggtgtcagaggaactctgccatgcagccatgaaaccagcc
accacagtgccctgtttggtgcaagtgtgcaccttcaggtgggaggtgaagccgtggagc
cagtgttcagtaccctgtggatatgggatccagtccagagctgtgtcctgcatgggcccc
tctaagcctgatcccctcagccccctgttctgcatgcacatgcccaagccaatcactatt
cagggctgcaacatgggagtctgcagtgatgtgctgtccaagtcagatgtggcctctgat
aataccactgcaataaatacggtcatgagggttaatctcacagaaaggcctctcctgtct
ccaaccgtgaccaataaagatacaacacagagtccgacagaggccatcaacatcccacag
accaccacagcaaccccaacacctaaatccagtgcatgtggacagctactcctggaggaa
tcaggcacggtggatttgaaacatgtaaccagccgctgcacggtatccataggtcgaccc
ctagatgaggtcattcacatcagagtgctatctagctccttggactgcacaaaaaaggaa
tacgtggcattttttgaccgactggcattcttgaggaagtgtgtgcaggtagctggtagt
gaactgatcagcagaacaaatgtcctgctggtgcgtcaacatcttctcccagctgggaac
gggattgtttttacctacagttcacagaaaaacatgaagaggagccatcaccgggactgc
gacattcagctgttttcccccagcggtgtctttgaaaatcccataatgtccagcactaac
cacacctgtcgagtgctcatcaacgcccctccctcagtgaagatcagaatccaagcgcag
cacataggattagtattcaacgccaccaactcccagtctacatacattatgatccgggac
atggatgtcctaaagaccaatgtgtttaaaggccaacagctgtttctgtggcactcctct
ggaaatatggccgagattgaatttcatggagactacctgcattccaaagggagctttaga
gcagaatattcctttctgcgtcgctga

DBGET integrated database retrieval system