KEGG   Amphiprion ocellaris (clown anemonefish): 111588065Help
Entry
111588065         CDS       T06018                                 

Definition
(RefSeq) glutamate receptor 1-like isoform X1
  KO
K05197  glutamate receptor 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111588065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aoce04040]
    111588065
Ion channels [BR:aoce04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   111588065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 111588065
NCBI-ProteinID: XP_023153962
Ensembl: ENSAOCG00000014969
Position
Unknown
AA seq 920 aa AA seqDB search
MQRSFTILYTSLLGMCLGSSSSFPSNINIGGLFPTESHEYEVFRFALSHHQDIPKLVPQV
DMVKMGNSFSMTYAFCSQFSKGVYAIIGLYDRKTVNMLMSFCGALHVCFVTPSFPIETAN
QFVIQLRPELQDALVGVIEHYGWIKFVYMYSSDSGLSVLQKVLDTAAERNWLVTSVNVET
MTEASFLKVFQDLDKRKEGQIIIDCETERLTGILRKIVEQGKNAKSYHYILANLGFLDID
LTDLRKGGANITGFQLVNNSEPSVSRVVQQWMEFDNKDSKVPRSGLKYTGALTYDGVKVM
STAFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRIDGLTGHIQFNEKGR
RTNYTVSVMELAPSGPKKVGYWNEDEKYVTTASFMRGSNETYGLQNRTYIVTTILESPYV
MLKKHHDQFSGNEKYEGYIVELAAEIAKHVGYQYKLKVVSDGKYGARDPETKMWNGMVGE
LVYGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHAEDYEEGGEPQSPTQASATNGVQQGQTPAQQNTN
QQSPEQTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLA
AFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVFEKMWSYMKAADPSV
FVKTTDEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSP
LRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIG
GLGLAMLVALVEFCYKSRTESRRMKQSINDAMRCSTLTRMSGNGSGGENGRILTHDFPKT
VQTLPCMSHTASMGLGASGM
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcttcaccatcctctacaccagtttactggggatgtgcttgggttcaagc
tcaagttttccaagtaacatcaatataggaggattgttcccaaccgaatcgcacgaatat
gaggtttttcgcttcgccctgtctcaccaccaggacatccccaaactggtgccgcaggtg
gatatggtcaaaatggggaacagcttctccatgacatatgccttttgctcccagttctcc
aaaggtgtgtacgccatcattggtctgtatgacaggaagacggtcaacatgctcatgtcc
ttctgcggggcgctgcacgtctgcttcgtcacgccgtccttccccatcgagacggccaac
cagttcgtcattcagctgaggcctgagctacaggatgctctggtgggagtcatcgaacac
tatggatggatcaagtttgtctacatgtacagttctgactcaggcctgtcagtgctgcag
aaggttctggatacagcagcagagaggaactggctggtgacctcggtcaatgtggagacc
atgactgaggcctccttcttgaaagtgttccaggatttggacaagaggaaggagggccaa
attatcatcgactgtgagactgagagactcactgggatactcagaaagattgtggaacaa
ggaaagaatgcaaagagctaccactacattctggccaacctgggtttcctggacattgac
ctgacagacctgaggaaaggcggtgccaacatcaccggcttccaactcgtcaacaactcc
gagccgagtgtgagccgcgtcgttcaacagtggatggagttcgataacaaagactccaaa
gtgcccaggagtggactcaaatacacaggcgctctcacatacgacggggtgaaagttatg
tccacggccttccagaatttgcggcgacagaggatagacatctctcgcaggggcaacgct
ggagagtgtcttgccaaccctccagctccctgggggcagggcatagacatccagagagcc
ctgcagcaggtccgtatagatggactgaccggtcacattcagtttaatgagaaaggccgc
agaaccaactacaccgttagcgtcatggagctggccccctccggaccaaagaaggtcggc
tactggaatgaagatgagaagtatgtgaccacagccagcttcatgagaggaagcaacgag
acctacgggttacagaacagaacttacatagtcaccactatcttggagtctccatatgtc
atgctgaagaagcaccacgaccagttttcggggaatgaaaagtacgagggctacattgtt
gagctggctgcagagatagccaagcatgtgggctaccagtacaaactcaaggttgtctca
gatggcaagtatggagccagagatcccgaaaccaagatgtggaatggcatggttggggaa
ctggtgtatgggaaagcagacgtggctgtagctccactcactatcactctggtccgtgag
gaagtgatcgacttctccaagcccttcatgtccctgggcatctccatcatgatcaagaaa
cccaccaaatccaaaccaggcgtgttttccttcctggacccgctggcttacgagatctgg
atgtgcattgtgtttgcctacattggggtcagcgtcgtcctcttccttgtcagccggttc
agcccgtacgagtggcacgctgaggactacgaggagggaggggagccccagtctccaacc
caagcatcggctaccaatggggtgcagcagggccaaacaccggcgcaacagaacaccaac
cagcagagtccagagcagaccaatgagttcggcatcttcaattccctttggttttcactc
ggcgccttcatgcaacagggctgcgatatatcaccacgctctctgtcgggccgcatcgtc
ggaggcgtgtggtggttcttcaccctcatcatcatctcgtcttacactgccaacctggcc
gcctttctgactgtggagagaatggtgtctcctatagagagcgccgaggatctggccaag
cagacggagatcgcctatggaacgctggatgcaggctccaccaaagagttcttcaggagg
tcgaagattgccgtgtttgagaagatgtggtcctacatgaaggcagctgacccgtccgtg
tttgtcaaaacgacagacgagggggtaatgagagtcaggaagtccaaagggaagtacgcc
tacctgctggagtccactatgaatgagtacatagagcagaggaaaccctgtgacactatg
aaggtgggagggaacctggactctaaaggttatggaatcgccacacccaagggttcccct
ctcagaaacccagtaaacctggcagtgttaaaactgaacgagcagggcctcttggacaaa
ttgaaaaacaagtggtggtacgacaagggagagtgcggcagcgggggcggggactccaag
gacaagacgagcgctctgagcctcagcaacgtggcgggagtcttctacatcctgatcgga
ggcctgggcctggccatgctggtggcgctggtggagttctgctacaagtccaggaccgag
tcgcgccgaatgaagcaatccatcaacgacgccatgcgctgctccaccctcaccaggatg
agtggcaacgggagcggcggagagaacggacgaatcctcacccacgacttccccaagacc
gttcagacgctgccctgtatgagccacaccgccagcatgggactgggtgcctctggcatg
tga

DBGET integrated database retrieval system