KEGG   Alkaliphilus oremlandii: Clos_2688
Entry
Clos_2688         CDS       T00607                                 

Name
(GenBank) pyruvate formate-lyase
  KO
K20038  choline trimethylamine-lyase [EC:4.3.99.4]
Organism
aoe  Alkaliphilus oremlandii
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Clos_2688
Enzymes [BR:aoe01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.4  choline trimethylamine-lyase
     Clos_2688
SSDB
Motif
Pfam: PFL-like Gly_radical DUF1798
Other DBs
NCBI-ProteinID: ABW20219
UniProt: A8MK87
Position
complement(2919280..2921649)
AA seq 789 aa
MSTERIAQLKKSYINTKPSICVERAIAFTNSHKKTEGEAMILRRAKAFKEVCKAVPVTIF
DQELIVGTPGIYKRSGFICPEFSWQWVEKEMDDFQNRSQDAYLIGEEQKEILKNDIFPYW
VGKSLEEAFLSRIPEETRKIAVDTGIVDNDSKWRSAVGEITPDYQDIIFVKGFGGIRAEA
MEKLRKLEPLSAEALEKINFYQAIIESCDGIINLAKRYSKKALEMAEAEKDVKRKEELIR
IHQVCKNIPENPPRSFYEAIQMVWFVQLGSILSENSLALNLGRFDQYMYPFYEKDLKDGK
IKEEEAQELIEALWLKLSEWVWAISKNTAQYFAGYNSFQNLTVGGRKRDGSDATNTISYM
ALKASKNVKTHQPGLSVRIHPDSPQEFLIAVCDLIREGTGFPAVHNDRIGSQMLLAAGLS
PEDARDWSNCGCVVPHFRKVGEWTSAVNINLAAALEYALNSGKSRITKEQMGLKEENHLG
MNSFKDIKDHFYRQLSNLIKHGVISSVIAQQIHTEMVPRPFLSTLVDGCMDKGVDLSKGG
AFYNIGPVLTGIGIADVANSLMAIKKLVYEDKKITLNQLNSALNNNWEDQEDLRKEALNC
PKYGNDIDEVDQIAVEISDFYNKEIKKYKDYFGVPFNSAFMGISNYIPAGSVIGATPDGR
RSGDPLTEGVSPHAGTDLTSPTAAMRSAAKINHDIHTGGTLLNVKLSPELLKTDKSLVNL
ASLIRAYFELGAFHVQFNVISVDTLRKAQENPEAYRDLLVRVAGYSTQFVNLSKEVQDAI
IQRTTYANM
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgagtactgagcgtatcgcccaattaaaaaagagctatatcaacaccaagccatccatc
tgtgtggaacgagcaattgcctttacaaactcccataagaaaacagaaggagaggcaatg
attcttagaagagcaaaagcctttaaagaagtatgtaaagcggtgcctgtcaccatattt
gatcaggaattaatcgtaggaaccccaggcatctataaaagatcgggctttatatgccct
gaattttcatggcaatgggtggaaaaagaaatggatgattttcaaaatagaagtcaagat
gcttatttaatcggcgaagaacaaaaagagattttgaaaaatgatatatttccatattgg
gtaggaaaatccctagaggaagcatttttatctagaatcccagaggaaaccagaaaaata
gcagtagatacaggaattgtagacaatgattcaaagtggcgaagtgcagtaggagagatt
accccagattatcaggatattatctttgtcaaaggctttggtggaatcagagcagaagcc
atggaaaagttaaggaagctagagcctctatcagcggaagctctagagaaaataaacttc
tatcaagccatcatcgaaagctgcgacggtattataaatcttgctaaaagatattctaag
aaagcattggaaatggcagaggctgaaaaagatgtcaagagaaaagaagagctgataagg
atccatcaggtctgcaaaaatattcctgaaaacccaccaagatcattttacgaggcgatt
caaatggtttggtttgttcaattaggctctattttatcagaaaattcactggcactgaat
ctagggcgcttcgatcagtatatgtatcctttctatgagaaagatttaaaagatggaaaa
ataaaagaggaagaggcacaggaattaatcgaagcactttggctcaaattatctgaatgg
gtatgggcgatttcaaaaaatacagcacaatactttgcaggatacaactccttccaaaac
ctaacggtaggtggaagaaagagagatggaagcgacgctaccaataccatttcatacatg
gcattaaaggccagtaaaaatgttaaaacccatcaaccgggactcagcgtaaggattcat
ccagattcaccgcaggaatttttaattgctgtatgtgacttaatccgagaaggaactgga
tttccagcggtgcacaatgatcgcatcggctctcaaatgcttttagcagcaggactttct
ccagaagatgctagagattggagcaattgtggctgtgttgtacctcattttagaaaggtt
ggagaatggacatctgctgtaaatatcaatctagcagctgcattggagtatgcattaaat
agtgggaaaagccgtattaccaaggagcaaatgggactaaaagaagagaatcatctagga
atgaactctttcaaagatatcaaagatcatttctatcgacagctttcgaatttaatcaag
catggcgtcatatcctctgtgattgcccagcagattcatacagaaatggtgccaagaccg
ttcctatccacccttgtagatggttgtatggacaaaggggttgacttgagcaaaggtggt
gctttttataacatcggacctgttctgactggaatcggtattgcagatgtggccaactcc
ctgatggccataaaaaaactagtgtatgaagacaaaaaaataaccctcaatcagctcaat
agtgccctgaataataattgggaggatcaggaggatctaaggaaggaagccttgaactgt
ccaaagtatggcaatgacatcgatgaagtggatcaaattgcagtggagatctctgatttc
tataataaagagattaaaaaatataaagattactttggtgtaccattcaactctgcattt
atgggtatttcaaactatattccagcaggtagcgttatcggtgcaacaccggatggtaga
agatctggggacccattaacagaaggtgtatcccctcatgcaggaacagaccttacaagc
cctacagccgccatgaggtctgcagcaaagatcaaccacgatattcatacgggaggaaca
cttttaaatgtgaagctttctccagaattattaaaaacagataagagcttagtgaacttg
gcttctctgattcgtgcttatttcgagctgggggccttccatgttcaattcaatgtaata
tccgtagataccttaaggaaggcgcaggaaaatccagaggcttatagagacttgcttgta
agagtagcaggatatagcacgcagtttgtgaacctgtcgaaggaagtacaggatgccatt
atccagcgaacaacctatgcaaatatgtag

DBGET integrated database retrieval system