KEGG   Alkaliphilus oremlandii: Clos_0258Help
Entry
Clos_0258         CDS       T00607                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00071  Fatty acid degradation
aoe00072  Synthesis and degradation of ketone bodies
aoe00280  Valine, leucine and isoleucine degradation
aoe00310  Lysine degradation
aoe00362  Benzoate degradation
aoe00380  Tryptophan metabolism
aoe00620  Pyruvate metabolism
aoe00630  Glyoxylate and dicarboxylate metabolism
aoe00640  Propanoate metabolism
aoe00650  Butanoate metabolism
aoe00720  Carbon fixation pathways in prokaryotes
aoe00900  Terpenoid backbone biosynthesis
aoe01100  Metabolic pathways
aoe01110  Biosynthesis of secondary metabolites
aoe01120  Microbial metabolism in diverse environments
aoe01130  Biosynthesis of antibiotics
aoe01200  Carbon metabolism
aoe01212  Fatty acid metabolism
aoe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Clos_0258
   00630 Glyoxylate and dicarboxylate metabolism
    Clos_0258
   00640 Propanoate metabolism
    Clos_0258
   00650 Butanoate metabolism
    Clos_0258
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Clos_0258
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Clos_0258
   00072 Synthesis and degradation of ketone bodies
    Clos_0258
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Clos_0258
   00310 Lysine degradation
    Clos_0258
   00380 Tryptophan metabolism
    Clos_0258
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Clos_0258
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Clos_0258
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Clos_0258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aoe04147]
    Clos_0258
Enzymes [BR:aoe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Clos_0258
Exosome [BR:aoe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clos_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABW17821
UniProt: A8ML04
Position
305004..306182
Genome map
AA seq 392 aa AA seqDB search
MREVVIVGAARTPIGSFGGALKDVSAADLGAIAIKGALDRAGVSPDMVDEVFMGCVLQGG
LGQNVARQSAIKAGIPNEVSSMTLNKVCGSGLRAVSLGAQTIIAGDNDIVVVGGTENMSQ
APYVLKDMRWGARMGDAKTIDTLTNDALTCAFNNYHMGMTAENLAEKYSISREEQDLFAV
GSQNKAEAAQKAGLFDAEIVPVTVQTRKGDIVVDKDEYIKYGTTIESVSKLRPAFKKDGT
VTAANASGINDGAAALIIMSKEKADELGIKPLAKIVAYASGGVDPAIMGYGPVASTEKVF
KKSGWAVEDLELIEANEAFAVQALSVAQGLNFNKDIVNVKGGAIALGHPVGASGARILVT
LLYGMEQRDAKKGLATLCIGGGMGTSLLVERI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagttgtaatcgtaggtgctgcaagaacaccaattggaagctttggtggggca
ttgaaagatgtcagtgcagcagatttaggagccattgcaattaaaggtgctttggataga
gctggagtttcgccagatatggtcgatgaagtgtttatgggttgtgttctgcaaggtggt
ttagggcagaacgttgcaagacaatcggcgattaaggcgggtataccaaatgaagtatcc
tctatgaccttaaataaagtatgtggttcagggctgagagctgtttccttaggtgcgcaa
accattattgcgggagacaatgacatcgttgtagttggtggaacagaaaatatgtctcaa
gcgccatacgttctaaaggatatgagatggggtgcaagaatgggagatgccaagaccatc
gatactttaaccaatgatgcattgacctgtgcttttaataattaccacatgggtatgacg
gcagaaaaccttgcagagaaatatagtatttctagagaagaacaggatctatttgcagta
ggaagccaaaacaaggcagaagctgcacagaaagcaggtcttttcgatgctgaaatcgta
ccagtgactgttcagacaagaaaaggcgatattgttgtagataaagacgaatacattaaa
tatggaacaacaattgaaagtgtatctaaattaagaccagcttttaagaaggatggtaca
gtaactgctgccaacgcttccggtatcaacgatggtgctgcagctcttatcattatgagc
aaagaaaaagccgatgaactaggcattaagcccttggctaaaatcgtagcttatgcatcc
ggtggagtagaccctgccattatgggatatggaccggtggcttctacagagaaagtattt
aagaaatctggatgggcggtagaggatttagagctcatcgaagcgaatgaagcttttgca
gttcaagcgctgtccgtagcacaaggcttaaacttcaacaaagacatcgtcaatgttaaa
ggtggtgccattgctttaggacaccctgttggagcaagtggtgcaagaatattggttaca
ttgctctatggaatggagcaaagagatgcgaaaaaaggcctagcaacattatgtatcggc
ggaggcatgggcacatctttattggttgaaagaatatag

DBGET integrated database retrieval system