KEGG   Alkaliphilus oremlandii: Clos_0623Help
Entry
Clos_0623         CDS       T00607                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00020  Citrate cycle (TCA cycle)
aoe00640  Propanoate metabolism
aoe00660  C5-Branched dibasic acid metabolism
aoe00720  Carbon fixation pathways in prokaryotes
aoe01100  Metabolic pathways
aoe01110  Biosynthesis of secondary metabolites
aoe01120  Microbial metabolism in diverse environments
aoe01130  Biosynthesis of antibiotics
aoe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Clos_0623
   00640 Propanoate metabolism
    Clos_0623
   00660 C5-Branched dibasic acid metabolism
    Clos_0623
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Clos_0623
Enzymes [BR:aoe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Clos_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABW18183
UniProt: A8MM16
Position
689318..690478
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKELLRDYGVPVPRGQVIYDVRDAQRAAWHIESDIAVVKAQIHAGGRGKAGGV
KIAKSITEVEQFSRELLGKTLVTHQTGQEGRVVKAILIEEGCEIYKEYYIAFTLDRENSK
IALIASEEGGMDIEEVAANRPDKILKEIIDPLIGLTDFQGRRVCFNLNIDGSLINDTVEL
MKNLYRCFIEKDCSLLEINPLVITKNNRVMALDAKINFDGNGLYRNEDVLKLRDLNEEDE
KEIEASKYNLSYISLDGNIGCMVNGAGLAMATMDIIKLYGGNPANFLDVGGGASEEKVMN
AFKIILSDPKVKGIFVNIFGGIMKCDVIAKGIVNAANEVKLNVPLVVRLEGTNVELGKEI
LNQSNLNIVTATTMADGAKKIVKLIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacatgaataccaagccaaggagctattgagagattatggtgtaccagttcca
agggggcaggttatttacgatgttcgtgatgcccaaagagctgcatggcatatagaatcg
gatattgccgtcgtgaaagcgcagattcatgcagggggaagaggaaaggctgggggcgta
aaaatagccaaaagtattacagaggttgaacaattctcaagagaattgctagggaaaaca
ttggttacccatcagacagggcaagaaggaagagtagtcaaggcaattttgattgaagaa
ggctgcgaaatatataaggaatattatatagcatttactttagatcgagaaaactcaaag
attgcgctaattgcctctgaagaagggggcatggatatagaagaggttgcagcaaatcgt
ccagataaaatattgaaggagatcatagacccattaatagggctcactgattttcaggga
agaagagtttgttttaatttaaatatagatggcagccttatcaatgatacggtggaattg
atgaaaaatttgtatcgatgttttatagagaaagattgttcattgctagagatcaaccct
ttggtgataacaaagaataaccgtgtgatggcattggatgccaaaattaatttcgatggc
aatgggctctatagaaatgaggatgtattaaagctaagagatttaaatgaagaagatgaa
aaggaaatagaagcgtctaaatacaatctatcctatatttctttagacggcaacattggg
tgcatggtaaatggtgcaggattggccatggccacaatggatatcatcaaactatatggt
ggaaaccctgccaacttcttagatgttggaggcggtgcaagtgaagaaaaggtaatgaat
gcatttaagatcatattatccgatcccaaggtaaagggaatattcgttaatatttttggt
ggcataatgaaatgcgacgtgatagcgaaaggaatcgtcaatgcagcaaatgaagtgaag
ttgaatgttcccttggtggttcgattggaaggtaccaatgtagaattgggaaaggagata
ttgaatcaatctaaccttaatatcgtcacagctacgaccatggctgatggggcaaaaaaa
atagtgaaattgataaaatag

DBGET integrated database retrieval system