KEGG   Alkaliphilus oremlandii: Clos_0863Help
Entry
Clos_0863         CDS       T00607                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00860  Porphyrin and chlorophyll metabolism
aoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clos_0863
Enzymes [BR:aoe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Clos_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO CTP_synth_N Peptidase_C26 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABW18412
UniProt: A8MET3
Position
942971..944476
Genome map
AA seq 501 aa AA seqDB search
MAKAIMVQGTMSNAGKSIITAGLCRIFAQDGYKVAPFKSQNMALNSYITKDGLEMGRAQV
VQAEASYKEPDVRMNPILLKPTSNRTSQVIVNGEILGNMPAGDYFKYKTKLIPDIMKAYN
SLAEENDIIVIEGAGSPAEINLKQEDIVNMGMAKLAKAPVLIAGDIDQGGVFASLYGTYM
LQSEEEKQYIKGTIINKFRGDLKILEPGLKMLEDLIHIPTLGVVPYMDIDIDDEDSLSDR
FSNKNSGGDVDIVVIRLPRISNFTDFNVFEYMEGVSVRYITKPSQLKNPDLVILPGTKNT
LGDLKWLRESGLEASILKYAAEGKPVFGICGGYQMLGKTLKDPWHVEEGGEISGLGLINA
ETVFEREKTRSRVKGQFHHLSGIFEGLNHKIFEGYEIHMGITTPLGGEAFTSSLEAMDGG
VKSDGLCSNNIYGTYVHGIFDEGQVAETIIRTLMEKKGLVYEPNKNFNMVEYKNKEYDKL
ADALRKALDMEAIYRILNEGI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagctataatggttcaaggaacgatgtccaatgcgggaaaaagtatcattact
gctggattatgtcggatttttgcacaggatggatataaagtagcgccctttaaatcgcag
aacatggcgctgaactcctatataacgaaggatgggcttgaaatgggaagggctcaggtt
gtacaggcggaagcatcatataaagagcccgatgttcgaatgaatcccattctattaaaa
cccaccagcaatagaacgtctcaagtcattgtcaatggagaaattttaggcaatatgccc
gctggagactattttaaatacaagacgaagctgattccagatattatgaaagcatacaac
agcttagcagaggaaaatgatatcatcgtcatcgaaggggctggtagccctgctgaaatc
aacttaaagcaggaagatatcgtcaacatggggatggcaaagctagcaaaagcacctgtc
ctaatcgctggtgacatcgatcaaggtggagttttcgcatcgttgtacggtacctatatg
cttcaaagtgaagaagagaagcaatatattaagggaacaattatcaataaatttcgggga
gatttaaaaatactagaaccgggtctcaagatgctggaggacttaatccatataccgacc
cttggtgttgtgccttatatggacattgacattgacgatgaagatagcctttccgatcga
ttttccaataagaattccggtggcgatgtggatattgtcgtcataagactacctagaatc
tccaacttcacagatttcaatgtctttgaatatatggaaggggtttctgtaagatatatc
accaaaccttctcagctgaaaaatccagatttagtcatcctgcctggtacaaaaaatact
ttaggtgatttaaaatggctgagagaaagtgggctagaagccagcattttaaaatatgct
gcagaaggaaagcctgttttcggtatctgtggtggataccagatgctaggaaaaacctta
aaagatccatggcatgtggaagagggcggagagatatcgggtttaggtttaatcaacgct
gaaacagtttttgaaagggaaaagactcgtagtagagtaaagggacagttccatcatctt
tcaggaatttttgaaggactgaatcataagatttttgagggatatgaaatccatatgggt
attacaacacccctaggaggagaagcgttcacatcttctcttgaggcgatggatggcggc
gtaaaatcagatggactctgcagtaataatatttacggaacctatgttcatggtatattt
gacgaaggacaggttgccgaaaccattattagaacattgatggaaaagaaagggcttgta
tatgagccaaataaaaattttaatatggtagaatataaaaataaagaatatgataagctt
gcagatgctttaagaaaagcactggatatggaagccatttatagaatcttaaatgaggga
atatag

DBGET integrated database retrieval system