KEGG   Alkaliphilus oremlandii: Clos_0884Help
Entry
Clos_0884         CDS       T00607                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00010  Glycolysis / Gluconeogenesis
aoe00020  Citrate cycle (TCA cycle)
aoe00620  Pyruvate metabolism
aoe01100  Metabolic pathways
aoe01110  Biosynthesis of secondary metabolites
aoe01120  Microbial metabolism in diverse environments
aoe01130  Biosynthesis of antibiotics
aoe01200  Carbon metabolism
Module
aoe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clos_0884
   00020 Citrate cycle (TCA cycle)
    Clos_0884
   00620 Pyruvate metabolism
    Clos_0884
Enzymes [BR:aoe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Clos_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_33
Motif
Other DBs
NCBI-ProteinID: ABW18431
UniProt: A8MEV2
Position
967656..969236
Genome map
AA seq 526 aa AA seqDB search
MNNVKELIDSGILKTNKIHYNLPVEELIKIAVEKEGGVIAKNGALCINTGKYTGRSPEDR
FIVDEPSVHDHINWNKGNKGISAQVFDNLFNKAMAHVKDKELFVFEGFVGSDLDYRMPIR
VINEFAYQNLFASQMFIKPKAGERENFDPEFTVLALPDLKADPAVDGTNSEVFIILNFAQ
KIVLIGGTRYSGEIKKSIFTVMNYLLPFKDVLPMHCSANIGEDGNVALFFGLSGTGKTTL
SADNNRKLIGDDEHGWTANGVFNFEGGCYAKCINLTEEQEPQIWNAIKHGAILENIVIDE
NTGHIDYDDDRYTENTRAAYPVEYIDDAVLEGKGGIPNTIIFLTADATGVLPPIAKLTKE
QAMYHFMSGYTSKLAGTERGIVEPTATFSTCFGGPFMLLKPQTYAKLLGEKIEKYNTRVF
LVNTGWTGGPYGIGSRMKLKYTRSMVRAAIKGELDQVEYIKDPIFNLSIPTTCPEVPVEV
LEPSKTWDNQDEYDQKANELAKSFVENFKKFDDVSDDIKNVNPKVQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatgttaaagagttgattgactcaggtattctaaaaactaataaaattcattat
aatctaccagtggaagaacttataaaaattgctgtggaaaaagaaggtggagtcatagcg
aagaatggggctctatgtataaataccggaaaatacacgggaagatctccagaagataga
ttcattgtagatgaaccatcggtacatgatcatattaactggaacaaaggaaataaaggt
atttctgcccaagtgtttgacaatctatttaataaagctatggcccatgtaaaagataaa
gaactatttgtttttgaaggttttgtaggttctgacttagattacagaatgccaattaga
gttatcaatgaatttgcatatcaaaatttatttgcatcgcagatgtttataaagcctaaa
gctggagaaagagagaactttgatccagaatttacagttcttgcattgccagatttaaag
gccgatccagcagtagatggtacaaattcagaagtgtttattattctgaactttgcacaa
aaaatagttctgatcggcggaacaagatacagtggagaaattaagaaatccatattcact
gtaatgaattacttattaccatttaaagatgttcttccaatgcattgctctgccaatatc
ggagaggacggtaatgttgcgctattctttggactatccggtactggaaaaaccacattg
tctgcagataacaacagaaagttaattggagatgatgagcacggatggactgccaatggt
gtatttaacttcgaaggtggatgttatgcaaaatgcatcaatcttacggaagaacaagaa
ccacaaatatggaatgcaattaaacatggcgcaattttagaaaatattgtaatcgatgag
aacactggtcatatcgactatgatgatgatagatatacagagaatacacgtgcagcttat
ccagtggaatatattgatgatgccgtattagagggtaaaggtggaattccaaataccatt
atcttcttaactgccgatgctacaggcgtattgcctccaattgcaaaactaacgaaagaa
caggccatgtaccactttatgtctgggtacaccagtaagttggctggaacagaaagaggc
atcgtagagccaaccgcaactttttcaacttgttttggaggaccattcatgctattaaag
cctcaaacctatgcaaagcttttaggtgagaaaatagagaaatacaatactcgtgtattt
ttagtaaatacgggatggacaggtggaccatacggtataggaagccgtatgaaactaaaa
tatacaagatccatggtaagagcggcaattaaaggggaattggatcaggtggaatatatt
aaggacccaatcttcaatttatccataccaacaacatgtccagaggtaccagtagaagta
ttagagccttctaaaacatgggacaatcaagatgaatacgatcagaaggcaaacgaactg
gcaaaaagcttcgttgagaattttaaaaagtttgatgatgtttctgatgatataaaaaat
gtgaatccaaaggttcaatag

DBGET integrated database retrieval system