KEGG   Alkaliphilus oremlandii: Clos_1559Help
Entry
Clos_1559         CDS       T00607                                 

Definition
(GenBank) peptidase M42 family protein
Organism
aoe  Alkaliphilus oremlandii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 Peptidase_M28 DUF5318
Motif
Other DBs
NCBI-ProteinID: ABW19102
UniProt: A8MFD9
Position
complement(1669840..1670892)
Genome map
AA seq 350 aa AA seqDB search
MYLEEILKNLTETSGVSGHEAEVREKVKAYFTEYCDDVQEDSLGNIIGLKRGTLGNGKSI
MLTGHLDEIGLMVKNIDENGFIQFTNIGGVDQRTLLCQEVIIHGKEKIYGVIGVKPPHIT
TEEERRNALEIEDLLIDTGFTKENLLDLVQVGDVITIKRNLLKLQNDWISGKALDDRAGI
ASLLACLKKLSNVKHEADVYVVATVQEEVGTRGAITSSYTIEPQIGIAVDVGFGKTPELS
QYDAIELGKGPAITVGPNIHPNIFNKIKQVAIDEYIDYQIEVAPGTSGTDAWPMQVSRSG
IATGVLSIPLRYMHTSVETISLSDIEKTGKLLANFIVALNEIEMEEFLCY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtatttagaagaaatacttaagaacttgacagaaacatcaggcgtttctggacatgaa
gctgaagtaagagaaaaggtaaaagcttatttcacagaatattgcgatgacgttcaggag
gattccttagggaatattattggactaaagagaggaactttaggcaacggtaaaagtatt
atgttaactggtcatttagatgaaattggtttaatggtcaaaaatattgatgaaaatggt
ttcatccaatttaccaatattggtggtgtagatcagcgtacacttttatgtcaagaggtt
attattcatggaaaagaaaaaatttacggtgttatcggagtgaagccacctcatatcacc
accgaagaggaaagaagaaatgctcttgaaatagaagacctattaatcgatacaggattt
acaaaagaaaacctgctggatctcgttcaagttggagatgttattacaattaaaagaaat
ttgctcaaattacaaaatgattggatttctggaaaagcactggatgaccgtgcaggcatc
gcctcattattggcatgcctaaaaaagttaagcaatgtaaagcatgaagcagatgtttat
gttgttgctactgtgcaagaggaagtaggaactagaggagcgattacatcctcttatacg
atcgaacctcagattggaatagcagtagatgtaggctttggtaagactccggaattgagc
caatacgatgccatcgagcttggaaaaggtcctgcaattacagtagggcccaatattcat
ccaaatatatttaataaaataaagcaagttgcaattgatgagtatatcgattaccaaatt
gaggttgctcctggtacttctggtacggacgcttggccaatgcaggtaagtcgatctggg
attgccacaggtgttttatcaatccctctaagatatatgcatacatctgtggagaccatc
agtttatcagatatcgaaaagacaggaaaattacttgccaattttattgttgcgttaaat
gaaattgagatggaggagttcttatgttattaa

DBGET integrated database retrieval system