KEGG   Alkaliphilus oremlandii: Clos_1609Help
Entry
Clos_1609         CDS       T00607                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00900  Terpenoid backbone biosynthesis
aoe01100  Metabolic pathways
aoe01110  Biosynthesis of secondary metabolites
aoe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Clos_1609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:aoe01006]
    Clos_1609
Enzymes [BR:aoe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Clos_1609
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Clos_1609
    2.5.1.29  geranylgeranyl diphosphate synthase
     Clos_1609
Prenyltransferases [BR:aoe01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Clos_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ABW19152
UniProt: A8MFI9
Position
complement(1716095..1716982)
Genome map
AA seq 295 aa AA seqDB search
MTFREQLQHYIDLTNEHLKDYFNMKEGYNQTLIESMKYSLFAGGKRLRPILSLASYQMFR
DDIEEVMPYACGIEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYNEGVAILAGDGLLNY
SFELMLENAIKQNDIYKHIVAIKEISNSAGVHGMIGGQVVDLESENKIIDKEMLDYIHIN
KTAALITTSLKVGAIIAGAQEEDIRNMEKVGLNLGLAFQIKDDILDVVGDEAKLGKSIGR
DLEKHKSTYPALIGLEASIEKVGALTNNVKQLLHRYSSKAEFLLELCDYLTSRES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacttttagggagcagctacagcactatatagacttaacgaatgagcatctaaaggat
tattttaatatgaaagaaggatataatcagactttaatagagtccatgaaatatagtttg
ttcgctggcggtaaaagattgagaccaattctttctttggcatcgtaccaaatgtttaga
gacgatattgaagaagtgatgccctatgcttgtggtatcgaaatgattcatacttattcc
ttgattcacgatgatttgccggctatggacaatgatgattatcgaagaggaaaattaacg
aatcacaaagtttataatgaaggcgttgctattttagctggcgatggtcttttgaattat
tcttttgaacttatgttagagaatgctatcaaacaaaacgatatatacaagcatattgtt
gccattaaagaaatttcaaatagtgctggagtccatggcatgatcggtggacaagtggtt
gatttagagagtgagaataaaattattgacaaagagatgctggactatatccacatcaac
aaaacagcagcattaattaccacatctttaaaagtaggggcgataattgctggtgcacaa
gaggaagatattagaaatatggagaaagtcggcctaaatttgggcttagcattccaaatt
aaagatgatatactggatgttgtaggagatgaagcgaagctaggaaagagtattggtagg
gacttagaaaagcataaatcgacctaccctgcattgatcggcttagaagcctccattgaa
aaagtaggggcattgactaataatgtgaaacagttacttcaccgatatagctctaaagca
gaatttttattggagttatgtgactatttaacgagtcgggagtcttag

DBGET integrated database retrieval system