KEGG   Alkaliphilus oremlandii: Clos_1695
Entry
Clos_1695         CDS       T00607                                 

Definition
(GenBank) cobalamin B12-binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00472  D-Arginine and D-ornithine metabolism
aoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Clos_1695
Enzymes [BR:aoe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Clos_1695
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ABW19235
UniProt: A8MGL2
Position
complement(1794518..1796725)
AA seq 735 aa
MELQPNKKLDVKNILQDLEQYTPKRRGWVWRKKEENLPMGPFTFNDMSTPLKNSIPLPSA
KYFGDIDPQPNNVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFDGLVEGTP
QGIGGIPITRKQVRAQRKALDLIEEEVGRPINYHSYISGVAGPEIAVMFAEEGVNGAHQD
AQYNVLYRNVNMIRSFVDAAEAKSLMVWADIAQIDGAHNANATAREAWKVMPELMVQHAI
NSMYSVKVGMNKGNICLSTVPPTAPPANCLKLDLPYAVALRETFKDYRMRAQMNTKYMES
STREATVTHVLNLLISRLTRADIQSTITPDEGRNVPWHIYNMEAIDTAKQALVGMDGLMD
MIELKDEGYLREKVREIKERSVLFMEEVLEVGGFFKAIEEGFFVDSGQYPERNGDGIARK
MDGGVGAGTVYERDADYFAPVTAHFGYNNVEQYGGDKSDPAKLIGGSTLEVPEKIIYIDE
LDETDNVNVRLEETKELRETSNIKPEVEWAGDGIIMMNLFMPTTKRVAEFAAIEMAKKMG
LEDVEVIHREVMHPAEGTRIELKGKVPFTIDTDALVIPPEPEIMSEDEVRAEIEKKPLKI
VAGTVGEDEHSVGLREIIDIKHGGIEKYGIECEYLGTSVSLEKLVDAAIELNADAILAST
IISHDEIHYKNMKRIHELCIEKGIRDRIMILCGGTQVTPEIAVKQGVDAGFGRGTKGIHV
ATFLVKRRNEMSNED
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggaattacaaccaaataagaaattagatgtaaaaaatatattgcaagatttagaacag
tatacgcctaaaagacgtggatgggtttggagaaagaaagaagaaaatttaccaatggga
ccgtttacatttaatgatatgtccacaccattaaaaaacagtattccattgccatctgca
aaatactttggggatattgatcctcagccaaataatgtgatcacaactgagattgcttcc
ggaagatttgaagatgatatcagaagaatgagaatggctgcttggcatggtgcagaccac
atcatggtaattagaactgctggacaaagtcacttcgatggattggttgaaggtacacct
caaggtatcggaggaattccaatcactagaaaacaagtgagggctcagagaaaggctcta
gaccttatcgaagaagaagtaggtagaccaatcaattaccattcctatatcagtggtgtt
gctggtcctgaaattgcggttatgttcgctgaagaaggtgtgaacggcgcgcaccaagat
gctcaatataacgttttatacagaaatgtaaatatgatccgttcttttgtagatgctgct
gaagcgaagagcttaatggtttgggcagatatcgcacaaattgacggtgctcacaatgcc
aatgctactgcaagagaagcttggaaggtaatgccagagctgatggtacagcatgcaatc
aactctatgtattctgtaaaagtaggaatgaacaaaggaaatatctgtttatcaacagtg
ccgccaacagcgcctcctgcaaactgcttgaagctagacttaccatatgctgttgctcta
agagagacgtttaaagattacagaatgagagcacaaatgaatacaaagtatatggaatct
tctacgagagaagcgactgtaacccacgtattaaaccttttaatttcaagacttacaaga
gcagatatccaatcaacaatcacaccggatgaaggtagaaatgttccgtggcatatatac
aacatggaagccattgatacagcaaagcaggctctagttggtatggatggactaatggat
atgattgaattaaaggatgaaggatatttaagagagaaagtaagagaaattaaagagaga
tccgttcttttcatggaagaagttctagaggttggtggattctttaaagctattgaagaa
ggattcttcgtagactctggacaatacccagaaagaaatggcgatggaattgctagaaaa
atggatggtggcgttggcgcagggactgtatatgaaagagatgcagattattttgctcct
gttacagcccactttggatataataacgtagagcaatatggtggagataaaagtgatcca
gcaaaattaattggtggtagtactttagaagtacctgaaaaaataatttatattgatgaa
ttagatgaaacagataatgttaatgtaagattagaagagacaaaagaacttagggaaact
tctaatattaaaccagaggttgagtgggctggagatggcatcattatgatgaacctattc
atgccgactactaagagagtagcagagtttgctgcaatcgaaatggctaaaaagatgggt
cttgaggatgtagaggtaattcatagagaagtgatgcatcctgcggaaggtacaagaatt
gagttaaagggtaaagtaccatttacaatcgatacagatgctttagttattcctccggag
ccagagattatgtctgaggatgaagtaagagctgaaattgaaaaaaaacctttaaaaata
gtagcaggtactgtgggcgaagatgagcactctgtaggattaagagagatcattgatatc
aaacacggtggtattgaaaaatatggtatcgaatgtgaatatttaggaacatccgtatct
cttgaaaaattagtagatgcagccattgaattaaatgcagatgcaattttagcatcgaca
atcatcagccatgatgagatccattataaaaacatgaagcgtattcatgagctatgtata
gaaaaaggtattcgtgatagaattatgattttatgtggaggtactcaggttactccagaa
atcgcggtaaaacaaggtgtagatgctggatttggaagaggaacaaagggtattcatgtt
gctacattcctggtaaaacgaagaaacgagatgagtaatgaagattaa

DBGET integrated database retrieval system