KEGG   Alkaliphilus oremlandii: Clos_1696
Entry
Clos_1696         CDS       T00607                                 

Definition
(GenBank) D-ornithine aminomutase S component
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00472  D-Arginine and D-ornithine metabolism
aoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Clos_1696
Enzymes [BR:aoe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Clos_1696
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067
Other DBs
NCBI-ProteinID: ABW19236
UniProt: A8MGL3
Position
complement(1796725..1797090)
AA seq 121 aa
MKRADDFQVRRAHLADLTDEQLEQKFWQLAEQIVDPLIDLARKNTTPSIERAVLLRMGFS
SIEAKAIVEGVIDRGLMSKGAGHVVYKVATDKNIDIREAGLALIDGKYWDDAVSLFKGGI
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaaagagcagacgattttcaagtgcgtcgtgcacatttagcagatttaacagatgaa
caattagagcaaaaattttggcaattagcagagcagatcgtagatccgctaattgatctt
gctagaaaaaacaccacaccgtctatagaaagagctgttcttttaagaatggggttctct
agtatcgaggcgaaagctattgtagaaggtgtgatcgatagaggattaatgagtaaaggt
gcagggcacgttgtttataaagtagcaacagataagaatatagatattagagaagcggga
cttgctttaatagatggtaagtactgggatgatgcagtaagcctttttaaaggagggatt
aaataa

DBGET integrated database retrieval system