KEGG   Alkaliphilus oremlandii: Clos_2306Help
Entry
Clos_2306         CDS       T00607                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00561  Glycerolipid metabolism
aoe00640  Propanoate metabolism
aoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Clos_2306
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Clos_2306
Enzymes [BR:aoe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Clos_2306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DUF5612 AIRC PFK ABC_sub_bind NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABW19839
UniProt: A8MJ57
Position
complement(2473016..2474119)
Genome map
AA seq 367 aa AA seqDB search
MLTVKLPQYTVGNGILKDLGSICKKYGKRILVIGGNTALEKVGMSIVDYLKQENIEIIDF
IWYGGECSYKNIDRIQTKAENLNIDVIVGVGGGKALDTAKAAGEKASIPVITIPTIAATC
AATTPLSVVYKDNGSFDSIYLLENLPAHILIDTDIIVNSPTKYLWAGIGDTLAKYYELEA
TTREKKLSHRVLMGKNLSTMCVEPLIAYGTKAIEDSSKGLNSFEFEETILNIIVTTGIVS
MLIGEEFNGACAHGLFNALTSLEHIEKDHLHGEVVSYGILVMLMLDGQESEVERLYPFYK
SISLPTSLEDLEIIHTIEYLESIVEDAIHMEDVKKMPYQVTKAMFLGAIDKLEGLNKRLN
HKKQTLK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcttactgtaaaattaccacagtatactgtaggaaatggaattttaaaagatttagga
tctatttgtaaaaaatatgggaaaagaatattagttataggcggaaataccgcacttgaa
aaagttggcatgagtattgtcgactatttaaaacaagagaatatcgaaattattgatttt
atatggtatggcggagagtgcagctataaaaatatagatcggatccagacaaaagcagag
aatttaaatatcgatgtaattgttggggtgggtggtggaaaggccttagatacagctaaa
gcggcaggagaaaaagcaagcattccagttataacaatacctacaatagcagctacgtgt
gcagctacaacgcctctttctgtagtatataaggataatggaagctttgactcgatctat
ttactagaaaatttgcccgctcatatattaatagacacagacatcattgtaaattctcct
actaaatatttatgggcaggcattggagatacactggctaaatattacgaactggaggca
actactagagaaaaaaagctatcccatcgcgtattgatgggaaagaatttaagtacaatg
tgtgtggaacctttaatagcctatggaacaaaggcgattgaggacagtagcaaaggattg
aactcttttgagtttgaagaaacgatattgaatattatagttacaacagggattgtatcc
atgttgatcggcgaagaatttaacggagcatgtgcccatgggttatttaatgcattaact
tctttggagcatattgaaaaagatcacctacatggtgaagttgtatcctatggaatctta
gtgatgttaatgctggacggccaggaaagtgaagttgaaagattatatcctttctataag
agcatcagtttgcccacatctttagaggatttagaaataatacataccattgaatatcta
gagtcaatagtagaagatgcaattcatatggaggatgtaaaaaaaatgccctatcaagtt
acgaaagctatgtttttaggagccattgataagctagaaggattaaacaaaagactgaac
cacaaaaaacaaactttaaaatag

DBGET integrated database retrieval system